KEGG   Colwellia sp. PAMC 20917: A3Q34_16585Help
Entry
A3Q34_16585       CDS       T04511                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
coz  Colwellia sp. PAMC 20917
Pathway
coz00071  Fatty acid degradation
coz00072  Synthesis and degradation of ketone bodies
coz00280  Valine, leucine and isoleucine degradation
coz00310  Lysine degradation
coz00362  Benzoate degradation
coz00380  Tryptophan metabolism
coz00620  Pyruvate metabolism
coz00630  Glyoxylate and dicarboxylate metabolism
coz00640  Propanoate metabolism
coz00650  Butanoate metabolism
coz00900  Terpenoid backbone biosynthesis
coz01100  Metabolic pathways
coz01110  Biosynthesis of secondary metabolites
coz01120  Microbial metabolism in diverse environments
coz01130  Biosynthesis of antibiotics
coz01200  Carbon metabolism
coz01212  Fatty acid metabolism
coz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:coz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3Q34_16585
   00630 Glyoxylate and dicarboxylate metabolism
    A3Q34_16585
   00640 Propanoate metabolism
    A3Q34_16585
   00650 Butanoate metabolism
    A3Q34_16585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3Q34_16585
   00072 Synthesis and degradation of ketone bodies
    A3Q34_16585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3Q34_16585
   00310 Lysine degradation
    A3Q34_16585
   00380 Tryptophan metabolism
    A3Q34_16585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3Q34_16585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3Q34_16585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A3Q34_16585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:coz04147]
    A3Q34_16585
Enzymes [BR:coz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3Q34_16585
Exosome [BR:coz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3Q34_16585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOW78315
UniProt: A0A1D8RYX8
Position
3868414..3869598
Genome map
AA seq 394 aa AA seqDB search
MSTTDPIVIVSASRTPMGGFMGGLSAVTSPDLGATAIRGALAAANIANDQVDEVIMGCVL
PAGLKQAPARQAALAADLALSTVCTTINKVCGSGMKAAMQAHDSLMAGSINVAVAGGMES
MTNAPHLLPKGRSGIKMGHGQILDHMMTDGLENAYDGIAMGCFAQETADDAGFTREDMDE
YAIRSLARANAAIAGGAFENEISPVTIKSRRGDSVFAIDEQPGNARPDKIPSLRAAFKRD
GTITAANSSSISDGAAALVMMKQSEAEKRGLRPLCKIVAHATHAQKPEEFTVAPVGAMNK
VLAKANWTAADVDLWEINEAFAMVTMLAIKELALDVEKVNVNGGACALGHPLGASGARIM
VTLIHALKNKGLSKGLASLCIGGGEATAIAVEMF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctactacagatcctattgttattgtttcagcgtctagaacccctatgggtggtttt
atgggcggattatctgctgtaacttcacctgacttaggcgcaacggctatacgcggcgca
cttgctgcggcaaatattgctaacgatcaagttgatgaagtaatcatggggtgtgtattg
cctgcaggtttaaaacaagcgcctgctcgtcaagcagctttggcggctgatttggcatta
tcaacagtttgtaccaccattaataaagtctgtggctctggaatgaaagctgcaatgcaa
gcacatgactcactaatggctggctctattaatgttgctgttgccggtggtatggaaagc
atgactaatgcaccgcaccttttacctaaaggtcgcagtggtataaaaatggggcatggt
caaattcttgatcatatgatgactgatggtttagaaaatgcgtatgatggcatagctatg
gggtgtttcgcacaagaaactgccgatgatgctgggtttactcgtgaagacatggatgaa
tatgctattcgctcattagcacgtgccaatgcagcgattgctggcggtgctttcgaaaat
gaaatatcgccagtaacgattaaatcgcgtcgtggcgactctgtctttgcaatagatgaa
cagccgggtaatgcccgccctgataaaataccttcattacgtgccgcttttaaaagagac
gggactattacggctgcgaactctagttcaatttcagatggtgctgcggcattagtgatg
atgaaacagtcggaagcagaaaaacgtggtttacgccctttatgtaaaattgttgctcat
gcaacgcatgcacaaaaacctgaagagtttaccgtagcacccgttggcgcaatgaataaa
gttttagcaaaagcaaactggacggctgcagatgttgatctatgggaaattaatgaagca
tttgccatggttaccatgttagcgattaaagaattagccttagatgttgaaaaagtcaat
gtcaatggtggcgcttgtgcactgggtcatcctttaggtgctagtggtgctcgtattatg
gtaacgttaattcatgcattgaaaaacaaaggtttatcaaaaggtttagcctctctttgt
attggtggtggtgaagctacagcgattgcggttgaaatgttttag

DBGET integrated database retrieval system