KEGG   Chlamydia pneumoniae AR39: CP_0007Help
Entry
CP_0007           CDS       T00029                                 

Definition
(GenBank) exodeoxyribonuclease V, beta chain, putative
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
cpa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CP_0007
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpa03400]
    CP_0007
Enzymes [BR:cpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CP_0007
DNA repair and recombination proteins [BR:cpa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CP_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Viral_helicase1 AAA_30 PDDEXK_1 AAA_12
Motif
Other DBs
NCBI-ProteinID: AAF37903
UniProt: Q9Z7G7
Position
complement(7687..10839)
Genome map
AA seq 1050 aa AA seqDB search
MKPFNIFDSNSSIQGKFFLEASAGTGKTFTIEQIVLRALIEGSLTHVEHALAITFTNAST
NELKVRIKDNLAQTLRELKAVLNSQPASLPTYLDINCNVKQIYMQVRNALATLDQMSLFT
IHGFCNFVLEQYFPKTRLIHKKPALTHSQLVLHHITNYLKQDLWKNVLFQEQFHLLAVRY
NVTSKHTSSLVDKLLASYTQPISSYFSSRVERLEQISLWHQQIYNSLLEIPKQVFLDQLT
AHISGFKKQPFSILDDLHHFVDLLYTSETHSSLFSFFKIAETFNFKHRLARYKPCAAFTV
LENMSWVERTLEFCNLDRIFNTLLVDLQEYLKQNYTPWLSPDESVFALEKLLSSSEAQPV
VQALREQYQLVLIDEFQDTDKQQWSIFSNLFISPKFTGSLFLIGDPKQSIYEWRSADLPT
YLTAKSSFSEDKQLQLVNNYRSTPKLMEAINQIFGKISPFLEIPGYLPIEYHALNPQSSE
TFENPPHAPIHFFFYETIKDQALWIFSEALRLQKEQKIPLGNMVVLVSDSNQAFELISYA
TIPVSFSKNKSIFHLTETHILTTALLEAILHPENYEKISKILFSSLFGLSLDEVTTKKED
FTIYFQSLHSYISHHGLLATFYRVMTTQGNVLFSSPRGDLIFQEMEKLCGYLDTISSYPY
HQLLHLKNFSETGRWEEELAISSYSEDLETLKITTIHSSKGLEYDIVFCPGIEKSKKNKS
SSELLREMYVACTRAKKQLYLPISTQPPSLQRSSALTNYVKLEGTQSSAYDLAIHLHQEH
PDLFSYSLPKDHGHATTVLNLPLLETFALKVTPPKTIFSFSSTKFLLDTHKDSQSIPYSK
LPISKQQLPLGEKTGILIHKILESIQFSLLQDTEYLMSTIMRFIKHTHLEGFEETILKLL
SKTFFSPLTFSSQTFSLSQVLPNKIFRETSFLFLENQELWQGVIDLFFEHEGKYYIIDWK
TSFLGETNSDYSKSNLSIYIKQEKLDYQGRIYVKAVRKFLNQFEIDDDVELGVIFIRGID
TQGNGFFALNSSEDIPNFNPKAIQKCQAYH
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccgtttaatatttttgactcaaactcttcgattcagggaaaatttttcctagaa
gcctctgcaggcacaggaaaaacatttactatagaacagatcgtgttgcgagccttgatt
gaaggctcgctaacacatgtagaacatgccttagcaattacatttacgaatgcttctacc
aatgagcttaaggttcgcatcaaagacaatcttgctcaaactttaagagaattaaaagcg
gttctaaactctcagccggcttctttacccacatatttagatatcaattgcaatgtaaag
cagatttacatgcaagttcgcaatgctcttgctactctagatcagatgtctttgtttacg
attcatggcttttgcaactttgttctagaacaatattttcctaagacccgtcttattcac
aaaaagcctgctctgacccactctcaattagttcttcatcacatcactaactatttaaaa
caagacctctggaaaaatgtactttttcaagaacagtttcatctattagcagttcgctac
aatgtaacctcgaagcatacatcttctctggtggataagctacttgccagctatacccaa
ccaatctcctcctacttttcctcacgtgttgaaagacttgagcaaatttctctttggcat
caacaaatatacaactctcttttagaaattccaaaacaggtttttctagatcagctaact
gcccacatctcaggatttaaaaagcagcccttttccattcttgatgatctccatcatttt
gtggatctcctttacacttcggagacccatagctctttattttcattctttaaaattgca
gaaacattcaacttcaaacaccgtcttgcacgttacaagccttgtgctgcctttactgtt
ttagaaaacatgtcttgggtagagcgtactttagagttttgtaacttggatcgaatcttc
aatactttgttagtcgatctccaagagtatcttaaacaaaattataccccttggctctct
cccgatgaaagcgtctttgccctcgagaaactactctcttcatctgaagctcaacctgta
gttcaagctcttagagagcaataccagctcgtattaattgatgaatttcaagatacagac
aagcaacaatggagcatcttttcgaatctctttatttctccgaaatttacaggatcgtta
tttcttatcggagaccccaagcaatctatttatgaatggagaagtgcggatcttcctacc
tatcttacagccaaatcttcgttttcagaagacaagcaactacagcttgtcaataattac
cgctctacacccaaactcatggaagccatcaaccaaatattcgggaaaatctctccattt
ttagagatccctggctacctacctatagaataccatgcgctaaatcctcagagtagtgag
acatttgaaaatcccccccacgctcctattcatttcttcttttatgaaactattaaagac
caggcattatggatattctcagaagcgctaagactacaaaaagaacaaaagattccccta
gggaatatggttgtcctggtctcagactcaaatcaagcttttgagttaatttcctatgcg
actattcctgtttccttttctaaaaacaaatctatatttcatcttacagaaactcacata
ctgactacagctctactagaagccattcttcacccggagaattatgaaaaaatcagcaag
atattgttctcatctctttttggactttctttagacgaagtcacaacaaaaaaagaagac
tttacgatttatttccaatcactacatagctacatctcacatcatggacttctggctaca
ttttaccgagtgatgactacgcaaggaaacgtattgttctcatctcctagaggggatctt
atttttcaggaaatggagaaactttgtggttacctagatacaatttcttcttatccctac
caccaacttcttcacctgaaaaacttttctgaaacaggacggtgggaagaagaactcgct
atatcttcttattctgaggacttggaaactttaaaaatcactaccattcactcttctaaa
ggtctcgaatacgatatagtcttttgtccaggaattgagaaaagtaaaaaaaataaaagc
tcttcagaattactaagagaaatgtacgttgcttgcacgagagcaaaaaaacagctgtac
ctacctataagcacgcaaccgccttctcttcagagaagctccgcattaacaaattacgtg
aaattagaaggtacgcagagttcggcttatgacttagctatccacctacatcaagaacat
cctgatttattttcgtattcgctacctaaggaccatggacatgctaccacagtgttgaat
ctgccacttttagagacgttcgctctaaaagtgacacccccgaaaactattttttccttc
tcatctacaaaattcctattggacactcacaaagactcgcaatcgatcccatattccaaa
ctcccgatttcaaaacaacagcttcctctgggagaaaaaacaggaattcttatacacaaa
attttagaatctattcaattttctctattacaagacactgagtacttgatgtctacgatc
atgcgtttcataaaacacactcatcttgaaggattcgaggaaacgattcttaaactactt
agtaagacgtttttttctcctttaacattttcatcgcagacattttctctatctcaagtt
ctaccgaataagatatttcgagagacttcttttttatttttagagaaccaagagctgtgg
caaggggtgattgatcttttttttgagcatgaaggaaagtactacattattgactggaaa
acatcgtttttaggagagacaaactccgattactcaaaaagcaacctatctatctacata
aaacaagaaaaattagattaccaaggcaggatctacgtcaaagctgtcaggaagttttta
aatcaatttgaaattgatgatgatgtagagcttggagttatctttatccgtggcatagac
acccaaggaaatgggtttttcgctttaaatagcagcgaagacattcctaacttcaatccc
aaagcaatccaaaaatgtcaggcctatcattag

DBGET integrated database retrieval system