KEGG   Chlamydia pneumoniae AR39: CP_0049Help
Entry
CP_0049           CDS       T00029                                 

Definition
(GenBank) translation elongation factor Ts
  KO
K02357  elongation factor Ts
Organism
cpa  Chlamydia pneumoniae AR39
Brite
KEGG Orthology (KO) [BR:cpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cpa03012]
    CP_0049
   03029 Mitochondrial biogenesis [BR:cpa03029]
    CP_0049
Translation factors [BR:cpa03012]
 Eukaryotic type
  Elongation factors
   CP_0049
 Prokaryotic type
   CP_0049
Mitochondrial biogenesis [BR:cpa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CP_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF_TS UBA UBA_4
Motif
Other DBs
NCBI-ProteinID: AAF37942
UniProt: Q9Z7K8
Position
complement(58135..58983)
Genome map
AA seq 282 aa AA seqDB search
MSDFSMETLKTLRQQTGVGLTKCKEALEACGGNLEEAVVYLRKLGLASAGKKEHRETKEG
IIAAKTDANGTALIEVNVETDFVANNAVFREFVSNLLNDILKYKVDTVEALSQAASSQDP
SLSVDELRAVTMQTVGENIRISRVAYFPKATNSTVGIYSHGNGKTVALTMLSGSSTADSL
AKDIAMHVVAAQPQFLSKESVPAEAIAKEKEVIASQIQGKPQEVIEKIVTGKLNTFFQEA
CLLEQPFIKNADLSIQSLIDDFSKTSGSSVAIEQFILWKIGA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttttctatggagaccctaaaaacattaagacaacaaactggtgtagggtta
acaaagtgtaaggaagctttagaagcttgcggtggtaacctagaagaagctgttgtctat
ttacgtaagttgggattggcatctgctgggaaaaaagaacacagagaaactaaagaaggc
atcatagcagctaaaactgacgccaacggcactgcattaattgaagtgaacgtagagaca
gattttgttgcaaacaacgcagtctttagagaatttgtttccaatctacttaatgacatt
ctcaaatacaaagtagataccgttgaagccctatcgcaagcagcctcgtcccaagatccc
tctctttctgtagacgaactcagagcagtgactatgcagactgtaggagaaaacatccgt
attagtagagtggcatactttcctaaggctacaaattctactgtaggaatttattcccat
ggcaacggcaagacagtagctctgactatgctttcaggctcctctactgctgacagctta
gcaaaagacattgcaatgcatgttgttgctgctcaacctcaattcctcagtaaagaaagc
gttcctgctgaagctattgctaaagaaaaagaagtgattgcttctcaaattcaaggaaaa
cctcaagaagttattgagaagatcgttacaggaaaattaaacacattcttccaagaagcc
tgtttattagaacaaccatttattaagaacgccgacctttctattcaaagtttaatagat
gatttctccaaaacctctggaagctctgttgcaatagaacagttcattttatggaaaata
ggagcctaa

DBGET integrated database retrieval system