KEGG   Chlamydia pneumoniae AR39: CP_0067Help
Entry
CP_0067           CDS       T00029                                 

Definition
(GenBank) phosphate permease family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpa  Chlamydia pneumoniae AR39
Brite
KEGG Orthology (KO) [BR:cpa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CP_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Microcin
Motif
Other DBs
NCBI-ProteinID: AAF73624
UniProt: Q9Z7M4
Position
77336..78616
Genome map
AA seq 426 aa AA seqDB search
MLPLIIFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVVIAAIFEFFGALLLGDR
VAGTIESSIVSVTNPMIASGDYMYGMTAALLATGVWLQLASFFGWPVSTTHSIVGAVIGF
GLVLGKGTIIYWNSVGIILISWILSPFMGGCVAYLIFSFIRRHIFYKNDPVLAMVRVAPF
LAALVIMTLGTVMISGGVILKVSSTPWAVSGVLVCGLLSYIITFYYVHTKHCSYISDTPK
KGSLTYRLKERGGNYGRKYLVVERIFAYLQIIVACFMAFAHGSNDVANAIAPVAGVLRQA
YPASYTSYTLIRLMAFGGIGLVIGLAIWGWRVIETVGCKITELTPSRGFSVGMGSALTIA
LASILGLPISTTHVVVGAVLGIGLARGIRAINLNIIKDIVLSWFITLPAGALLSILFFFA
LRALFH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcttccattaatcatttttgtccttctatgtggcttttatacttcttggaatatagga
gctaatgatgtcgctaatgctgtaggccctagtgtaggatctggggtattgacattgcga
caagccgtggtcatcgctgctatctttgagttttttggtgctctccttcttggagatcgt
gttgcagggactatagaaagtagtatcgtttctgtgaccaatcctatgattgcctctggg
gactatatgtacggcatgacggcagccttactagcaacaggcgtgtggttgcagctggcc
tctttttttggttggcccgtctcaacaacgcattctatagttggagctgtgattggcttt
ggattggtccttggtaagggaacaatcatttactggaattccgtaggcattattttaatt
agctggattctctccccttttatgggtgggtgtgttgcttacctgatcttttctttcatt
cggcgccatattttttataagaatgatcctgttcttgctatggttcgtgttgctccgttt
ttagcagctttggtgatcatgactttaggaaccgtgatgatctctgggggcgtgatcctt
aaggtttcttcaactccctgggcagttagtggggttctggtttgtggacttctaagttat
atcattacgttttactacgtccataccaagcactgttcctacatttcagatacaccaaaa
aaaggcagtcttacctatcgtttgaaagaacgaggcggaaattatggaagaaagtatctt
gttgtagaaagaatctttgcctacctacagattatcgtagcttgctttatggcgtttgct
cacggatctaatgatgttgctaatgccattgctcctgtagctggagtcttgcgtcaggca
tatcctgcttcctatacgtcgtatacattaattaggctcatggcatttggaggcataggc
ttggtcataggccttgcgatttggggatggcgtgttatagaaactgtaggctgtaaaatt
accgagttaaccccgtctcgagggttttccgtggggatgggctcagcattaacaattgct
ttagcttctattttaggacttcctatatctacgacacatgttgttgttggagctgtttta
ggaataggtttagcacgagggatccgtgccattaacttaaacattatcaaagatattgta
ctctcctggtttattacgcttcctgcaggagctttattatccatactctttttctttgct
ttaagagctttgttccattaa

DBGET integrated database retrieval system