KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CPAST_c08620Help
Entry
CPAST_c08620      CDS       T03811                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpae  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpae00071  Fatty acid degradation
cpae00072  Synthesis and degradation of ketone bodies
cpae00280  Valine, leucine and isoleucine degradation
cpae00310  Lysine degradation
cpae00362  Benzoate degradation
cpae00620  Pyruvate metabolism
cpae00630  Glyoxylate and dicarboxylate metabolism
cpae00640  Propanoate metabolism
cpae00650  Butanoate metabolism
cpae00900  Terpenoid backbone biosynthesis
cpae01100  Metabolic pathways
cpae01110  Biosynthesis of secondary metabolites
cpae01120  Microbial metabolism in diverse environments
cpae01130  Biosynthesis of antibiotics
cpae01200  Carbon metabolism
cpae01212  Fatty acid metabolism
cpae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPAST_c08620 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CPAST_c08620 (thlA1)
   00640 Propanoate metabolism
    CPAST_c08620 (thlA1)
   00650 Butanoate metabolism
    CPAST_c08620 (thlA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPAST_c08620 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CPAST_c08620 (thlA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPAST_c08620 (thlA1)
   00310 Lysine degradation
    CPAST_c08620 (thlA1)
   00380 Tryptophan metabolism
    CPAST_c08620 (thlA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPAST_c08620 (thlA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPAST_c08620 (thlA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPAST_c08620 (thlA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpae04147]
    CPAST_c08620 (thlA1)
Enzymes [BR:cpae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPAST_c08620 (thlA1)
Exosome [BR:cpae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPAST_c08620 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJA46962
UniProt: A0A0H3J2E8
Position
946902..948080
Genome map
AA seq 392 aa AA seqDB search
MKEPVIVSAVRTAIGAFGKSLKDIPAVDLGAVVIKEAVKRAGIKPEEINEVILGNVLQAG
LGQNPARQAAIKAGLPTEIPAFTLNKVCGSGLRTVSLAAQIIKAGDADIIVAGGMENMSR
APYLVDNAGFGYKMGNGQFIDEMIKDGLWDAFNDYHMGITAENIAEKWEITREEQDEFSV
KSQNKAEKAIKSGEFKDEIVPITVKTRKGEFVFDTDEQPRFGSNVESLSKLRPSFKKDGT
VTAGNASGLNDGAAALVIMSAEKAKELSIKPLAKIVSYASSGLDPKIMGYGAFYATKAAL
DKIDLKAEELDLIEANEAFAAQSIAVTRDLKIDLNKVNVNGGATALGHPIGGSGARILAT
LLHAMQKRDVKRGLATLCIGGGQGTALIVERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacctgtaatagttagtgcagtcagaacagccataggagcctttggaaaaagc
cttaaggatataccggcagtggatttaggagctgtagtaataaaagaagcagttaaaagg
gcaggaataaaaccagaggaaatcaatgaagttattttagggaatgttctccaggcaggg
ttaggtcagaatccagcaagacaagcagcaataaaagcaggattgcctacagaaattcca
gcttttactcttaataaagtatgtgggtcaggcttaagaactgttagcttagcagctcaa
ataatcaaagctggggatgcagatataattgtagcaggtggtatggagaatatgtcaaga
gcgccttatttagttgataatgctggatttggttataaaatgggtaatggacagtttatt
gacgaaatgatcaaggatggtttatgggacgcctttaatgactatcatatgggaataact
gctgaaaacatagcagaaaagtgggaaataacaagagaagagcaagatgaattttcagtt
aaatcccagaataaagctgaaaaggctataaagagtggagagtttaaagatgaaatagta
cctataacagtaaaaacaagaaaaggtgaatttgtatttgatacagatgaacaaccaaga
tttggaagcaatgtggagtcattatcaaaattaaggccatcttttaaaaaagatggaacg
gttactgcgggaaatgcatctggactaaatgatggagcagctgcattagttataatgagt
gcagagaaagcaaaagaattaagcataaagccgctagctaagattgtttcttatgcatca
tctggattagacccaaagataatgggttacggtgctttttatgctacaaaagctgcttta
gataaaatagacttaaaagctgaagaattagacctaattgaagccaatgaagcttttgca
gctcaaagtatagcggtaacaagagatttaaaaattgatttgaataaagtaaatgtaaat
ggaggagcaacagcattaggacatcctataggaggttctggagcaagaattttagctaca
ttattgcatgctatgcagaaaagagatgtaaagagaggactagctacattgtgcataggt
ggaggacagggaactgcattaatagttgaaagagactaa

DBGET integrated database retrieval system