KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CPAST_c11000Help
Entry
CPAST_c11000      CDS       T03811                                 

Gene name
bcd2
Definition
(GenBank) acyl-CoA dehydrogenase, short-chain specific
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cpae  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpae00071  Fatty acid degradation
cpae00280  Valine, leucine and isoleucine degradation
cpae00410  beta-Alanine metabolism
cpae00640  Propanoate metabolism
cpae00650  Butanoate metabolism
cpae01100  Metabolic pathways
cpae01110  Biosynthesis of secondary metabolites
cpae01120  Microbial metabolism in diverse environments
cpae01130  Biosynthesis of antibiotics
cpae01200  Carbon metabolism
cpae01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CPAST_c11000 (bcd2)
   00650 Butanoate metabolism
    CPAST_c11000 (bcd2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPAST_c11000 (bcd2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPAST_c11000 (bcd2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPAST_c11000 (bcd2)
Enzymes [BR:cpae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     CPAST_c11000 (bcd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AJA47200
UniProt: A0A0H3J851
Position
1185608..1186747
Genome map
AA seq 379 aa AA seqDB search
MNFDLTEQQQLIQKTARDFAENELKPRVIENDENSKFQVDTYKKMGELGLIGMPYPKEYG
GFGGDYLSYVLAVEEISKIDGSVGISYSVSTSLCSGGIFNNASEEQKKKYLPDVLSGKKF
GSFGLTEPNAGSDASGVQTTAVKQGDYYILNGSKCFITNGPLSETFFVIASTDRSKGAKG
LSAFIVEKDFSGFSIGKIENKCGIRAAQVSELVFEDCKVPVENLVGQEGKGLGMALSTLD
GGRIGVAAQGLGIAEGAFNVAKKYMTERVQFGKPLFKNQYLAFKMAELELEIEQAKYILY
KAALDKQNKRPYGLSAAKAKLACTDAAMHVTVEAVQMLGGNGYMREYNVERMMRDAKITQ
IYEGTNEIQKLIISGAIFR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgatttaacagaacaacagcaattgatacaaaaaactgcaagagattttgct
gaaaatgaacttaaacctagagttatagaaaatgatgaaaatagtaaattccaagtagat
acttataaaaagatgggagaactagggcttataggaatgccatatcctaaagaatatggt
ggatttggaggagattatttatcctatgtattagcagtagaagaaatatcaaaaatagat
ggatcagtgggtatttcctattcagtaagtacctccctctgttcagggggtatatttaat
aatgcttctgaagaacaaaagaagaaatatcttccagatgtacttagcgggaaaaaattt
ggctcttttggacttacagagccaaatgcaggttctgatgcttcaggagtacagactacc
gccgtaaagcagggagattattatatattaaatggatcaaaatgttttatcaccaatggt
cctctatcagaaacatttttcgtaattgcctctacagatagaagtaaaggtgctaaggga
ctctctgcatttattgtagaaaaggatttttcaggcttttctataggaaaaattgaaaat
aaatgtggtataagagctgctcaggtttcagaattagtttttgaagattgtaaagttcca
gttgaaaatctggttgggcaggaaggaaaggggttaggaatggcacttagtactcttgat
ggaggaagaataggtgttgcagctcaaggccttgggatagctgaaggtgcttttaatgta
gctaaaaagtatatgactgaaagagtacaatttggtaaaccactatttaaaaatcaatat
ttggcttttaaaatggcagaactagaacttgaaatagagcaggccaaatatattctatat
aaggctgctttagataaacaaaataagaggccttatgggttatctgctgctaaagcaaaa
cttgcatgtacagatgcagctatgcatgtgactgtagaagctgtacagatgcttggtgga
aatggatatatgagagaatacaatgtggaaagaatgatgagagatgctaaaataactcaa
atttatgaaggaacaaatgaaattcaaaagcttatcatcagcggagcaatattccgatag

DBGET integrated database retrieval system