KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CPAST_c35340Help
Entry
CPAST_c35340      CDS       T03811                                 

Gene name
cysG
Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cpae  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpae00860  Porphyrin and chlorophyll metabolism
cpae01100  Metabolic pathways
cpae01110  Biosynthesis of secondary metabolites
cpae01120  Microbial metabolism in diverse environments
Module
cpae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cpae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPAST_c35340 (cysG)
Enzymes [BR:cpae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CPAST_c35340 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CPAST_c35340 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH F420_oxidored 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJA49594
UniProt: A0A0H3J7Y8
Position
complement(3800232..3800870)
Genome map
AA seq 212 aa AA seqDB search
MNQYYPIMLNIKNRKCGVVGGGKVAHRKILSLLECGAEVIVVSREIIQDIEILVQKNKIQ
YIEDNYNFKYISDLYLVYAATDEYYTNVEIYNQCSKNNILVNVVDEPEVCNFIVPSKVKR
GDLTIAISTNGKSPMLARKIREDLEKVYDDRYEIFLGIMGNVRKEAFNIIKDSKRRSDFY
RHIIYSDFIIRLSYDNRDLIEQEIMSILMSYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatactatcctataatgttaaatataaaaaatagaaaatgcggggttgtagga
ggaggaaaggttgcacatagaaaaatattatctttgttagaatgtggagctgaagttatt
gttgtatccagagaaataatacaagatattgaaatattagtacaaaaaaataaaattcag
tatatagaggataattataattttaaatatatttcagatttatatcttgtatatgctgct
acagatgaatattatacaaatgtagaaatatataatcaatgtagtaaaaataatattctt
gtaaatgtagtggatgaaccagaggtttgtaattttatagtgccatctaaagtcaaaaga
ggagatttaacaattgctatatctactaatggtaaaagtcctatgcttgcaagaaagata
agagaagatctagaaaaagtttatgatgatagatatgagatttttttaggtataatggga
aatgtgagaaaagaagcatttaatattataaaagatagtaaaagacgaagcgacttttac
agacacataatatattcagattttataatcagattgtcttatgataatagggatttaata
gaacaggaaataatgagtattttaatgagttatagatga

DBGET integrated database retrieval system