KEGG   Carica papaya (papaya): 110807371Help
Entry
110807371         CDS       T05151                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00450  Selenocompound metabolism
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110807371
Enzymes [BR:cpap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     110807371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS Methyltransf_31 PrmA Methyltransf_25 Met_10 Methyltransf_12 Methyltransf_32 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 110807371
NCBI-ProteinID: XP_021888187
Position
Unknown
AA seq 1074 aa AA seqDB search
MAFHSVDDFLKECRQSGDAAYAAFRSVLERLEDPNTRTRARIFLSELYNRVGSSDQCLQT
YHFRIQDIYLDQYEGYQGRKKLTMMVIPSIFIPEDWSFTFYEGLNRHPDSIFKDRTVAEL
GCGNGWISIAIAEKWLPLKVYGLDINPRAVKVSWINLYLNALDERGQPIYDEEKKTLLDR
VEFHESDLLAYFKDNGIQLERIVGCIPQILNPNPDAMSKMITENASEEFLHSLSNYCALQ
GFVEDQFGLGLIARAVEEGISVIKPLGIMIFNMGGRPGQAVCERLFERRGVRVTKLWQTK
ILQAADTDISALVEIEKNSPHRFEFFMGLSGDQPICARTAWAYGKSGGRISHALSVYSCQ
LRQPAQVKIIFEFLKSGFQEISSSLDLSFEDDSVADEKIPFLAYLASVLKENSYFSFEPP
AGSQRFRNLVAGFMKTYHRIPLSSNNIVVFPSRSVAIESALRLFSPRLAVVDEHLTRHLP
RKWLTNLALERTATGDSSEDELTVIEAPHQSDLMIELIKKLKPQVVVTGMAHFEAVTSSA
FVHLLDITREVGCRLFLDISDHFELSSLPGSNGVLKYLAGNPLPSHAAIVCGLVKNQVYS
DLEVAFVITEEEAIFKALSKTVEVLQGNTAPISQNYYGCIFHELLAFQLADRHPAAERES
EKAKSGEMIGFSNSAISLLDNAELSISDAENSLLIHMDVDQSFLPIPSPVKAAIFESFAR
QNMAESEIDVAPSIKQFIKSNYGFPTDSTTELVYADGPQALFNKLVLCCIQEGGTLCFPS
GSNGIYVSAAKFLKANVFSIPTDCSDNFKLTDKMLTKVLKTVKKPWVYISGPTIVPTGLL
YSNKEMEDILSTCTKFGARVVIDTSFSGLEFNSNGWGGWNLESTLSKLNPPLSVSLLGGM
SLNLLNGALKFGFLALNQQILVDAFHSFPGLSKPHTTSKYAVKKLLNLREQRPGELLDVI
AEQVRNLEDRSKRLKETLENCGWDVIQPCAGVSMVAKPTAYLNKTVKLGNALKDGIKLDD
SNIREVFVNQTGLCLNSGSWTGIPGYCRFTFALEDNEFEQALERIVKFRSVISN
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcactccgttgatgacttcctgaaggagtgccggcagtccggtgatgccgcc
tacgctgcttttagatccgtacttgaacgcctcgaggatccgaatacccgaactcgtgcg
cggatcttcctctctgagctctacaatcgagtcggctcctccgatcagtgtcttcagact
tatcatttccggatccaggatatctacttggatcaatacgaaggttatcagggcaggaag
aaactgacaatgatggtgatccccagtatttttatccctgaagattggtcattcactttt
tatgaaggattaaacagacatccagactctatattcaaggacagaacagttgcagagctt
ggctgtggaaatggatggatatccattgccattgctgagaagtggttgcctttgaaggtg
tatggcctcgatattaatcctagagcagtaaaggtctcttggataaacctatacttaaat
gctctggatgagaggggtcaacccatctatgatgaagagaagaaaactttactggacaga
gtggagttccatgagtctgatcttctggcttattttaaggataatggcattcagcttgaa
cgaattgttggatgcatacctcagattcttaatccaaatccagatgctatgtctaagatg
atcacggaaaatgcaagtgaagaatttctacattctttgagtaactattgtgcacttcag
ggttttgttgaagaccagtttggcttaggtctcattgccagggcagtggaggaaggaata
tctgtaatcaaacctcttggtatcatgattttcaatatgggaggtcgtcctgggcaagct
gtttgtgaacgcctgtttgaacgtcgtggtgttcgtgtcaccaagctttggcagactaaa
attcttcaagcagctgatacagatatttcagccttggttgaaattgagaagaacagtcca
caccgttttgaattttttatgggactttccggagaccagcctatttgtgctcgaacagca
tgggcatatggaaaatctggtggtcgtatctctcatgctttgtcagtttacagttgtcaa
cttcgtcaaccagctcaggtgaagataatttttgagtttcttaaaagtggctttcaagag
atcagcagttccttagatttatcttttgaggatgattctgttgcggatgagaagatccca
ttcctagcttatcttgccagtgttttgaaggagaattcgtatttctcatttgagccacca
gctggaagccaaagatttcgtaatcttgttgctggctttatgaaaacataccaccgtatt
cccctctcttccaataatattgttgtctttccatcaagatctgtggcgattgagagtgct
ctgcggttattctcccctcgtcttgctgttgttgatgagcacctgacacgacatctaccc
aggaaatggttaacaaacttagcacttgagagaactgctactggtgattcatctgaagat
gaattaactgtcattgaagcaccacaccagtctgatttgatgatagagctcataaagaaa
ctgaagccacaggttgtggttactgggatggctcactttgaggctgtaacgagctcagct
tttgtgcacctgttagatattacaagagaagttggatgtcgtctttttttagacatatct
gatcactttgaattatccagccttcctggttccaacggggtcctaaaatatctggcagga
aatcctctaccctcacatgcagcaatagtttgtggcctggtgaaaaatcaggtttattca
gatttagaagtcgcctttgtcattacagaagaggaggcaatttttaaggccttgtccaag
accgtggaagtattacaagggaatactgctccaataagtcaaaattattatggatgtatt
ttccatgaactgctagcatttcagcttgctgatcgacatccagctgccgagagggaaagt
gaaaaggccaagtcaggagagatgattgggttttctaattcagccatttctctactggac
aatgctgagttgtcaattagtgatgctgagaacagtttgttgattcacatggatgtggat
caaagcttcctacccataccttctcctgtgaaagctgctatttttgaaagttttgcgaga
cagaacatggctgagtccgaaatcgatgtcgcccctagtatcaaacaatttattaagagc
aattatggtttcccaactgatagcaccacagaacttgtgtatgcagatggcccacaggcc
ttgtttaataagctcgttctttgctgcattcaagaaggtggaacattatgtttcccatct
ggctcaaatgggatttatgtttctgctgcaaaattcttaaaagcaaatgtttttagtatc
cctactgattgcagcgataacttcaagctaacagacaagatgcttaccaaagtacttaag
actgtgaagaagccatgggtgtacatttctggtcccacaattgtcccaactggtttgctt
tacagcaacaaagagatggaagatatattaagtacttgcacgaagtttggggcaagagtt
gttattgatacttcattctcaggattggaattcaactccaatggctggggtggctggaac
ttggaaagcacattatcaaagctaaacccacctctttctgtgtctctacttggagggatg
tctctgaatttgcttaacggagcactaaaatttgggtttctggctttaaaccagcaaatt
ttggttgacgcatttcatagctttcctggattaagcaaaccacataccactagtaaatat
gctgtaaaaaagttgctcaatctgagagagcaaagaccaggagaacttttggatgtgatt
gcagaacaagtaagaaatttggaggacagatctaagcgcttgaaggagacactcgagaac
tgtgggtgggacgtcattcaaccctgtgctggtgtttcaatggtagcaaaaccgacggcc
taccttaacaaaactgtaaagcttggaaatgcacttaaagacggaatcaagcttgatgac
tcaaatatcagggaagtctttgtcaaccaaactggattgtgtctcaacagtggctcatgg
actggaattccgggttattgtcgcttcacattcgcgctggaagacaacgaatttgagcag
gcactagaacgcatagttaaatttaggagtgtcatcagcaactga

DBGET integrated database retrieval system