KEGG   Carica papaya (papaya): 110807834Help
Entry
110807834         CDS       T05151                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 3 isoform X1
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00562  Inositol phosphate metabolism
cpap01100  Metabolic pathways
cpap04070  Phosphatidylinositol signaling system
Module
cpap_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110807834
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110807834
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     110807834
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     110807834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 110807834
NCBI-ProteinID: XP_021888789
Position
Unknown
AA seq 357 aa AA seqDB search
MRLQEEKVPFKVEEAEKIEDEKEDEEDMSTPCSLGIDAFPQQQQQRRLVVVGYALTSKKI
KSFLQPKLERLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWRQILEDYRQTHPDV
TVLDPPDAIQHLHNRQSMLQCVADMNLSDTYGKVGVPRQLVIKKDASSIPDAVGMAGLRL
PLVAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVR
RFSLPDVTKRELSKHAGVFRFPRVSCAAASADDADLDPSVGELPPRPLLERLAKELRRRL
GLRLFNLDIIREHGTSDRFYVIDINYFPGYGKMPEYEHIFTDFLLGLVQSQYKKRSY
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgcaggaggagaaggtaccttttaaggttgaagaagcggaaaaaatagaggac
gaaaaagaagacgaagaagatatgtctactccttgttcattagggattgatgcatttcct
caacaacaacaacaaaggagactggttgttgttggatatgctcttacctccaagaaaatt
aagagctttttgcagcctaaactcgaaagattagctaggaataaggggatattatttgtt
gccattgatcaaaataggcccctttccgatcaaggcccttttgacattgtgttgcacaag
ttaactggaaaagaatggcgtcagattcttgaggactaccggcaaacacatccagatgta
acagttcttgatcctcctgatgctatacaacatttgcataatcgccagtcaatgcttcag
tgtgttgctgacatgaatttatctgacacttatggaaaagttggtgttcccaggcaatta
gtcataaagaaagatgcgtcatctattcctgatgcggttggcatggctggccttaggcta
ccccttgttgctaagccgttggttgctgatggaagtgcaaaatcacatgaactatcactt
gcttacgaccagtattctctccagaagcttgaacccccacttgttcttcaggagtttgtt
aaccatggaggtgtcctcttcaaagtttatattgttggagaagctataaaagtggtcagg
cgattctctttacctgatgtcaccaaacgagagctgtctaaacatgctggtgtctttcgg
tttccacgggtatcttgtgcggcagcctctgcagatgatgcagatttggatcccagtgtt
ggtgagcttcctccacggcctttactggagagacttgcaaaggaacttcgtcggcgactg
ggtcttcggctgttcaatttagatattatcagagagcatgggaccagcgatcgattttat
gtcattgacattaactacttccctgggtacgggaaaatgccagagtatgaacacatcttt
accgacttcctcttgggtctggtgcaaagccagtacaaaaaaagatcttattag

DBGET integrated database retrieval system