KEGG   Carica papaya (papaya): 110811076Help
Entry
110811076         CDS       T05151                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
cpap  Carica papaya (papaya)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr YukC ABC1 DUF3930 APH
Motif
Other DBs
NCBI-GeneID: 110811076
NCBI-ProteinID: XP_021893140
Position
Unknown
AA seq 470 aa AA seqDB search
MSFSYHPYQTSYQDSQDEFNKATDDFDSAVKWAVAGSIISGLVITIAIVAVIYALIDCLK
KAGTSIPSYAQLATSDRIGKASYSEKEQRSSEHVSIAIPHVLQVPNHSQVQMEFPTMERF
LSNMEKEKPIRFSSDQIASFTEEYSTILGSGGFGVVFKGLVPNGTQVAVKVLTDALDHKS
IEGQFMAEVSTMGRTNHINLVKLFGFCFDRSTRALVYEYMEKGSLDGILFNENREVEWQK
LNEIAIGTAKGIAYLHEECQERIIHYDIKPANILLDANLTPKVADFGLAKLCKRDESSQV
QLTGYKGTPGYAAPELWMPFPVTHKCDVYSFGILLFEILGRRRHHDINATESCQWLPRWT
WEMFNNNELVVMLSLCGIEEKDRGKAEKMAMVALWCVQYSPEERPLMSSVVKMLEGDTEI
PQPPNPFKHLEPYIPVDSGSNDWSTSVTDRESSGQSHLKSNRRCDIELAN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagctaccacccttatcagactagctatcaagattctcaagacgagttcaat
aaggccaccgatgacttcgattctgcagtaaaatgggctgttgcaggttctatcatttct
ggcctggtgataaccatagcaattgtagctgtgatctatgctcttattgactgcttgaaa
aaggcaggcacttcgatcccttcgtatgcacaacttgccacaagtgatcgtattggtaaa
gcttcatactcagaaaaagaacaacgatcatcagaacatgtttcaattgcaatacctcat
gttcttcaagtcccaaatcattcacaggtacagatggagtttccaacaatggagagattc
ttaagcaatatggaaaaagagaagccaatcagattctcatctgaccagattgcaagtttt
acagaagagtattcaacaattctaggatctggtggctttggtgtagttttcaaaggatta
gtaccaaatggaacacaggtagctgtaaaagtactaactgatgccctagatcataagagc
attgaaggtcaattcatggcagaagtcagcactatgggcagaactaatcatatcaatctg
gtaaaactcttcgggttctgcttcgacagaagtactcgagcacttgtttatgagtacatg
gagaaaggttctcttgatggaatcttgtttaatgagaacagagaggtagaatggcagaag
cttaatgaaattgcaataggcactgcaaaaggaatcgcatatttgcacgaggaatgtcaa
gagaggatcattcattacgatataaaaccagctaacatacttcttgatgccaatttgacc
ccaaaagtagctgatttcggattagcaaagctttgtaaaagagatgaaagcagtcaagtc
caattgacaggctacaagggaacaccagggtatgcagcacccgagctatggatgcctttt
cctgtgactcacaagtgtgatgtctatagttttggtatccttctgttcgagatcttagga
agaagaagacaccatgatattaatgccactgagtcatgtcaatggttgccgagatggaca
tgggaaatgtttaacaacaacgaattagtagtcatgttatcgctctgtgggatagaagag
aaggatagagggaaagcagagaagatggctatggtggctctatggtgtgttcagtattcg
ccagaggagaggcctcttatgagctctgtggtgaagatgttagagggagatacggaaata
cctcagccaccaaatcctttcaaacatctggagccatacatacctgtcgatagcggatca
aatgactggagcacttccgtaacagacagagaaagctctggacagtctcacttaaaatca
aataggagatgcgacattgaattagccaactag

DBGET integrated database retrieval system