KEGG   Carica papaya (papaya): 110813429Help
Entry
110813429         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpap01001]
    110813429
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110813429
Protein kinases [BR:cpap01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110813429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr WAK_assoc GUB_WAK_bind Kinase-like Haspin_kinase ABC1
Motif
Other DBs
NCBI-GeneID: 110813429
NCBI-ProteinID: XP_021896252
Position
Unknown
AA seq 681 aa AA seqDB search
MIQNAAFSLIVNLFLLSFIFSHVVVLCVVDSQFRTCSVPKSCGDGQIIKFPFSIHGGRES
FCGFPGFELSCNDNGNPVLQLPDNQYVVRQISYNNQSLRISDAVFNHINKTTTVCRDFPP
IQNLTLLEDRFRVLSRGKLFLLYNCNLSSGSRNLEQYKISCDGGNRNGTALTTLALPSEE
EEGLALKECGNDAVMVPVVVDESGRGESTRELLSRGFWVKWVASNCSICEESGGKCGFDE
STYHFKCFCPDRPHAWRCNTSTGHDYGWKIATCTAAVFFVVIVLFAVFMLPRYRKIKSLS
SQLFSRSTSYHSKKLDLEAGRVYFGVPIFSYSELEEATNNFANDKLLGDGGFGTVYHGKL
RDGREVAVKRLYEHNYRRXEQFMNEVEILTCLHHKNLVSLYGCTSRHSQELLLVYEFISK
GTVADHLHGDQANPSSLTWPTRMNIAIETASALTYLHASDIIHRDVKTTNILLDDNFTVK
VADFGLSRLFPSDVTHISTAPQGTPGYVDPQYHQCYQLTDKSDVYSFGVVLVELISSLPP
VDITRNRNEVNLSNLAVNKIQNCEFEELIDPNLGYESDEEVRRMTTLVAVLAFKCLQQDP
EIRPTMEEVLDELKKIQSGECKLENAETRQDEPQLMKNKEAPPSPPDSDKVALLMKIKFP
SSPNSVTEKWFSTDTTPNTSG
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaacgctgcgttttcgctgatagtaaacctcttcctcctctctttcattttt
tcacatgtcgtcgttctctgcgtcgtcgactcgcagttccggacctgtagtgtccctaaa
tcatgcggtgacggccaaataatcaagttcccgttttccatccacggcggccgagaaagc
ttctgcggcttccctggcttcgagctctcttgcaacgacaatggaaacccagttctccaa
ttacccgataaccaatacgtcgtccgccagatctcttacaacaaccaatctcttcgcata
tccgacgccgttttcaaccacataaacaaaaccaccaccgtctgtcgtgacttcccacca
atccaaaacctgaccttactcgaagaccggttccgcgtcctgtctcgagggaagctcttc
ttgctttacaactgtaacttatcatccggcagccggaatcttgaacaatacaagattagc
tgcgatggcgggaatcggaatggaacagcgttgacgactctggctctgccgtcggaggag
gaggagggtttggcgttgaaggagtgtgggaacgacgctgttatggttccggtcgtggtg
gacgagtcggggagaggtgagtcgactcgtgagttgctgagtcggggattctgggtgaag
tgggtggcgagtaattgcagtatatgcgaggagagtggaggcaagtgtgggttcgacgag
tctacttatcatttcaagtgtttttgccctgatcgacctcatgcttggcgctgcaatact
tctactgggcatgactacggatggaagatagcaacatgtactgcagcagtcttcttcgtt
gtaattgtcttatttgccgtcttcatgcttccgcgataccgtaaaataaaatctctgtca
tcacagttattctcaaggagtacttcttatcactccaaaaaattagatctggaagcaggc
agagtgtattttggagttcccatcttttcttacagtgaacttgaagaagccactaacaat
tttgccaatgacaagttacttggagatggaggctttggaaccgtataccatggcaaactt
cgagatgggagggaagtcgcagtcaagcgtctatatgagcacaactatagaaggngtgag
cagttcatgaatgaggtcgaaatcttgacatgtctgcaccataaaaatcttgtctccctc
tatggttgcacttcgcgtcacagccaggaactcctgcttgtatacgagttcatatctaaa
ggcactgttgctgatcatctccatggtgatcaagcaaatcctagttcattaacatggcct
actcgtatgaacattgccatagaaactgcaagtgcattaacctatctccatgcatcagat
atcatacaccgtgatgtgaaaactaccaacattctccttgatgataactttactgtcaaa
gttgcagattttgggctttcccgattgttcccaagtgatgtaactcatatatcaactgct
ccacagggaactcctgggtatgttgaccctcaatatcaccaatgctatcagctcactgac
aaaagcgacgtctacagcttcggagttgttcttgtcgagctgatatcatccttgcctcca
gttgacataactaggaataggaatgaggttaacttatctaatttagcagtaaacaagata
caaaactgtgaatttgaagagttgattgacccaaatcttgggtatgaatctgatgaagaa
gttagacgaatgacaactttagttgcagtattggcatttaaatgtttgcagcaggatccg
gaaattagacctaccatggaagaggttctggacgaattaaagaaaatccaaagtggggaa
tgcaagttggagaatgcagagacaagacaggatgaacctcagttgatgaagaataaagag
gccccaccgtcaccacctgacagtgataaagttgcattactaatgaagatcaagttccct
tcttcaccgaactctgtgactgagaagtggtttagtacagatactacaccgaataccagt
ggatga

DBGET integrated database retrieval system