KEGG   Carica papaya (papaya): 110813549Help
Entry
110813549         CDS       T05151                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member H1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00010  Glycolysis / Gluconeogenesis
cpap00053  Ascorbate and aldarate metabolism
cpap00071  Fatty acid degradation
cpap00280  Valine, leucine and isoleucine degradation
cpap00310  Lysine degradation
cpap00330  Arginine and proline metabolism
cpap00340  Histidine metabolism
cpap00380  Tryptophan metabolism
cpap00410  beta-Alanine metabolism
cpap00561  Glycerolipid metabolism
cpap00620  Pyruvate metabolism
cpap00903  Limonene and pinene degradation
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110813549
   00053 Ascorbate and aldarate metabolism
    110813549
   00620 Pyruvate metabolism
    110813549
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110813549
   00561 Glycerolipid metabolism
    110813549
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110813549
   00310 Lysine degradation
    110813549
   00330 Arginine and proline metabolism
    110813549
   00340 Histidine metabolism
    110813549
   00380 Tryptophan metabolism
    110813549
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110813549
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110813549
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110813549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110813549
NCBI-ProteinID: XP_021896429
Position
Unknown
AA seq 487 aa AA seqDB search
MGSEVRMKVFGADEASELMKELRITAASGRTRSYDWRVAQLKNLLKICEYHEPEIVAALR
EDLSKPELESILYEVAILKNSIGLALKELKHWMMPEKAKTSITTFPSSAEIVPEPLGVVL
LISAWNYPFLLSLDPLVGAVAAGNAAVLKPSEISPATSSLLAKLVGEYMDSSAIRVVEGA
VAETTALLEQKWDKIFYTGNGRIGRIVMAAAAKHLTPVVMELGGKSPVVVDSGINLQVAA
RRIIAGKWGCNNGQACISPDYIITTEDYAPKVVDALKGELEAFYGKNPLLSKDLSRIVNS
NHFARLIKLLDEDKVSSKIVYGGERDSANLRIAPTILLDVPRDSLIMTEEIFGPLLPIIT
VDKLEDSFDVINSGTKPLAAYLFTNDKKLKQKFVMTVSAGGLVVNDTTVHVAVHTLPFGG
VGESGIGAYHGKFSFDAFSHKKAVLYRSLAGDAAIRYPPYTDGKLRLLKAMIGGNIMGII
RALLGFA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgaagtgcggatgaaagtattcggtgcagatgaagcgagcgagcttatgaag
gaattgagaatcaccgccgcctccggcaggacacggagctacgattggcgagtggctcag
ctgaagaatctgttgaagatatgcgaatatcatgaaccagagattgtcgctgctctgcgt
gaggacctatccaagcctgaactcgaatccatactctacgaggtcgccatactgaagaac
tcaattgggttggcactcaaggaactgaaacactggatgatgccagaaaaggctaaaact
tcaattacaacttttccttcatcagctgaaatcgtgccagaaccgttgggcgttgtattg
ttaatctcagcttggaactatccttttttgttgtctcttgatccactagttggagcagtt
gcagccggtaatgctgctgttctaaagccctcagaaatttctccagctacgtcctcattg
cttgcaaaattggttggagaatatatggatagctctgctataagggttgttgaaggggct
gttgctgaaacgactgcattattggagcagaagtgggacaaaatattttacacaggaaat
ggaagaattggacgtattgtgatggccgctgctgcaaagcacctgacacctgttgttatg
gagttaggtggaaaatctccagttgttgttgactcgggcatcaatctacaagttgcagct
cggcgcataattgcagggaaatggggctgtaataatggacaagcatgcatttctcctgac
tacattatcacaacagaagattatgctccgaaagtggtggatgccctgaagggtgaactt
gaggcattttatgggaagaatccgctgctgtcaaaggacttatcccgtattgtcaattcc
aatcactttgctcgcttgataaagctcttggatgaggataaggtttctagtaaaattgta
tatggaggtgaaagggacagtgccaacctgagaattgctccaaccatcttgcttgatgtc
ccacgagattctctgataatgactgaggaaatatttggccctctgctcccaattattacg
gttgacaaattggaagacagttttgatgtgataaactcgggaacaaagccacttgcagca
tatttattcaccaatgacaagaaattgaagcagaaatttgtaatgaccgtctccgcaggg
gggctagttgtcaacgacactactgtccatgttgcagtgcacacattaccattcggggga
gttggggagagtggtataggcgcataccatgggaaattctcctttgatgctttcagtcat
aaaaaagcagttctatatcgaagtcttgccggcgatgcagccatcaggtatccaccatat
acagatgggaagctaagattgcttaaggctatgattggtgggaatataatgggcataatc
cgagccctgctcggatttgcttag

DBGET integrated database retrieval system