KEGG   Carica papaya (papaya): 110813953Help
Entry
110813953         CDS       T05151                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00511  Other glycan degradation
cpap00600  Sphingolipid metabolism
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110813953
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    110813953
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     110813953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 110813953
NCBI-ProteinID: XP_021896935
Position
Unknown
AA seq 582 aa AA seqDB search
CYSNLISHLFIRVCRRYTKFYGTSERTAADLVHDALTNYKKWEEEIEKWQCPILNDERLP
EWYKFTLFNELYFLVAGGTIWIDSPLCDLNIRDDWHQPSKADNSDTKATETEVTIRQGGV
TEHSISSNCSSFENVGLKGIDESAVPSEENVLLGPQDDEDNDVGRFLYLEGVEYVMWCTY
DVHFYASFALLELFPKIELNIQRDFAKAVLSEDGRKVKFLAEGKWGIRKVRGAVPHDLGT
HDPWNEMNAYNIHDTSKWKDLNSKFVLQVYRDFAATGDMSFGVDVWPAVRAAMEYMEQFD
RDNDDLIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQLGDKFFAEMCKNKF
FNAKAAIEAKLWNGSYFNYDSGSSSNSKSIQADQLAGQWYSGSSGLPSLFDDYKIKSALQ
KIYSFNVLKIRGGKMGAVNGMHPNGKIDETCMQSREIWTGVTYALAATMILEGMEEEAFT
TAEGIFTAGWSEEGYGYWFQTPEAWTIDGHYRSLIYMRPLAIWGMQWALSLPKAILEAPK
INIMDRVHLSLRSSRFSYNEMGVRKIATKAKCLGNSAFNCTC
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
tgttactctaaccttatttctcatttattcatccgtgtttgcaggagatacaccaaattt
tatggcacttctgaaagaacagctgcagacttggtgcatgatgctctcacaaattacaag
aagtgggaagaagagatagagaaatggcaatgtcctatcctcaacgatgaaaggctacca
gaatggtacaagttcacattgtttaatgagctctactttttggttgctggtggaacaatt
tggatagactctcccctatgtgatctaaacataagagatgattggcatcagccatcgaaa
gcggataattcagataccaaagcaacggagactgaagtgactatcaggcaaggtggagta
acagagcatagtatttccagcaattgtagtagttttgagaatgttggactgaaaggaata
gatgaatcagcagttccttcagaagagaatgtacttttgggtccacaagatgatgaagat
aatgatgttgggaggtttctatacttggaaggagtggaatatgtcatgtggtgcacatat
gatgtccacttctatgcatcctttgcccttcttgagctttttcctaaaattgaactcaat
attcaacgtgactttgccaaagctgtcttatctgaagatggacggaaagtaaaattttta
gcagagggtaagtggggaattcggaaggttagaggagctgttcctcatgatttaggaaca
catgatccatggaatgaaatgaatgcctataacatacatgatacaagcaaatggaaagat
ctaaactcaaagtttgtactccaggtgtatagagactttgctgcaacaggagatatgtca
tttggagtcgatgtgtggccagctgttcgtgctgcaatggagtacatggaacagtttgat
agggacaatgatgatctcatcgagaatgatggatttccagatcaaacttatgatacttgg
acagtacatggggtgagtgcctactgtggttgtctgtggctagctgcactccaagctgca
gctgcaatggcgcttcaattaggtgacaaattttttgctgaaatgtgcaaaaataaattt
tttaatgcgaaagcagcaattgaagccaaattgtggaatggttcttactttaattatgac
agtggatcaagtagtaacagtaaatccatacaagctgatcaactggcagggcaatggtat
tccggatcgtcaggcttgccgtcactttttgatgattataaaatcaaaagtgctctacag
aaaatatatagtttcaatgtcttgaaaatcagaggaggcaagatgggggctgtaaatgga
atgcatccaaatgggaagatagatgaaacctgcatgcaatcaagagagatatggactggt
gtcacctatgctctagcagcaaccatgatcctcgaaggaatggaggaagaggcattcact
acggcagaaggtattttcactgcaggctggtcagaagaaggttatggatattggttccag
actcccgaggcgtggaccattgacggacactaccgatccctcatatatatgagaccactc
gctatctggggcatgcaatgggctttatcattgcctaaggcaattcttgaggcccctaag
atcaatataatggacagagtacatttatctctcaggagttcaagattctcttataacgaa
atgggtgtcagaaagattgcaaccaaagctaagtgcttgggaaattcggcattcaactgc
acctgctga

DBGET integrated database retrieval system