KEGG   Carica papaya (papaya): 110814878Help
Entry
110814878         CDS       T05151                                 

Definition
(RefSeq) probable leucine-rich repeat receptor-like protein kinase At5g49770
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpap01001]
    110814878
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110814878
Protein kinases [BR:cpap01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110814878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase ABC1 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 110814878
NCBI-ProteinID: XP_021898152
Position
Unknown
AA seq 576 aa AA seqDB search
MNAACVLDFNAYPYKPVGDCLQNNKKVLYWNSIPSTLCCQNVLTSFSKSLALHAHTTNHG
NIFIEENLWTNCSGSFHRQRYASVPLCGLDNFFYGGGECSKLSLEVIQNKKTYQTAVAWC
SGFNPSFDDACSACYAAVSSAIESMLEELRRHDDDNEKAVCGFAVVTSIAATLLNDSYAT
DDFYRCLSALDVIEPGYFKVKNILAKALLAIIIATITLIFILVLIKYLATNKNKNKNKNK
SNMRRKSPLKNVDGKEVTFSSLYRFNKDEIENAINLENGRQYLGRGSAGQVYKGYLPSGQ
AVAIKHINKSSSSDSFVREVEGLSRIRHPNLVCLFGVCIEDGEQYLVYEYCAAGNLAQHL
LRKDTALTWEKRVKILRDCALALRYLHHYIDGCIVHRDIKLTNILLTENLEAKLSDFGLA
RMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVTLQLLSGQRVIELDLDA
REHLTRKAKDVSMGRRPLTDFEDPRLNGNVNSADFESILHIAVLCIAKSSKGRPTIDVVF
EEIEKAWKNTVTEMKSNVEINSTETSMAKSMEVIPV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcatgtgttttagatttcaatgcatacccttataagccagttggtgactgt
cttcaaaacaacaagaaagtcctttactggaatagcattccctcaactctttgctgtcaa
aatgtgctcacttccttctcgaaaagcctagcactccatgcgcataccacgaatcatggc
aatattttcatagaagaaaatctatggacaaattgtagtggctcttttcataggcaacga
tatgcatctgtgccattgtgtggcctggataattttttctatggaggcggtgagtgctca
aaactctcgttggaagtaattcagaataagaagacgtatcaaacagctgtagcttggtgt
tctgggtttaatccttcatttgatgatgcctgcagcgcatgttatgctgctgtatcgtct
gcaatcgagtctatgcttgaggagcttagaaggcatgatgatgataacgagaaggcagtg
tgtggattcgctgttgttacttctattgctgctacattattgaatgattcgtatgcaact
gatgatttttataggtgtttatcagctttggatgtgattgaaccaggttatttcaaagtc
aaaaatatcctcgcaaaagcactattggcaataattatcgcgacaatcacactaatattc
atccttgttctgataaagtacctcgcaacgaataagaacaagaacaagaacaagaacaag
agcaatatgagaagaaaaagtcctcttaaaaatgttgatggcaaagaggttacgttttca
agcctctatagatttaacaaggacgagattgaaaatgcaataaaccttgaaaatggaaga
caatacctaggccgaggaagtgctgggcaggtttataaaggttacttgcctagtgggcaa
gctgttgccatcaagcatatcaataaaagtagctcgtctgattcttttgtaagggaagtt
gaaggtctttccaggattcgacatcctaaccttgtttgtttattcggtgtctgcattgag
gatggagaacaatatttggtctacgaatattgtgctgcaggaaatttagctcaacatcta
ctaagaaaagatactgctcttacatgggaaaaaagggtaaaaatcttaagagattgtgca
cttgcattgagatatctccatcactatatagatggatgtatagtacacagagacattaag
cttactaatatccttttaactgagaacttggaagcaaaactctccgattttggattggca
aggatgcttggaatggaagaaagtaaagtattcacagatgtgaggggtaccataggctat
atggacccagaatacatgagcaatgccaagctaacatgtgctagtgatatatatagtttt
ggtattgttactttgcagcttttatcaggacaacgagtcattgaactagatctcgatgcc
agagaacacctcaccagaaaggcaaaggatgtgagtatgggaaggcgaccacttactgac
ttcgaagatccacgattaaatggaaatgtcaatagtgcagatttcgaatcaatcttgcac
attgctgttctatgtatcgcaaaatcaagcaaaggtcgccccaccatcgatgttgtcttc
gaggagattgagaaggcttggaagaacacagtgactgaaatgaaaagtaatgtggagata
aactcgacagaaacatccatggccaagtctatggaagtgattccagtttga

DBGET integrated database retrieval system