KEGG   Carica papaya (papaya): 110815440Help
Entry
110815440         CDS       T05151                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase 4, chloroplastic isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00030  Pentose phosphate pathway
cpap00480  Glutathione metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01200  Carbon metabolism
Module
cpap_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cpap_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    110815440
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110815440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpap04147]
    110815440
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     110815440
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     110815440
Exosome [BR:cpap04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   110815440
  Exosomal proteins of colorectal cancer cells
   110815440
  Exosomal proteins of bladder cancer cells
   110815440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 110815440
NCBI-ProteinID: XP_021898931
Position
Unknown
AA seq 650 aa AA seqDB search
MSTSFLQVSVSFSEASLHPPICSSRRAVSTSTLLVISLLNMRIIYASLFLRVPLQYYFYL
VRRRNNGSVRSRHLVPCGGGSNFCQMFCHFKQWILKSLDVPKHRRKTGSVTVNQFKILEK
YDGHRPRKHLEPTLWIDKQIQDQGYVEKMVVTASQSKGTMVETHSLNFPDEGSEGPSLCI
AVIGATGELAKGKIFPALFALYYSGFLPEDVGIFGYSRKNLTDEELRSIIASTLTCRIDH
QQNCGNKMDAFLSRTYHINGGFDNKDGMSRLNARMEQIEGGSEANRIFYLSVPQEALLDV
ACSLSDYAQTQKGWNRIIIEKPFGFDALSSQQLTKSLLSKYEEKQIYRIDHLLGKNLIEN
LTVLRFSNLVFEPLWSRTYIRNVQVILSEELGVQRGRYFDGYGIIRDIVHSHILQTIALL
TMEPPISLDGEDIRNEKVKVLRSIRKLIPGDFVLGQYKSSSRDKIDINLNSLTPTFFASA
LYIENARWDGVPFIIQAGMGLIKHRVEIRIQFHQVPGNLYRGYFGSSMDHVANELILSDV
PDEAILVKVNNKVPGLGMQLDASELNLLYKDRYNVEIPDSYEHLLLDVIDGDNHLFMRSD
ELAAAWNILTPVLQEIDKKNIAPEVYEVGGRGPIGAYYLLAKHGVRWVDD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgtcatttttacaggtctcggtgtctttctccgaagcttcactgcatccaccg
atctgctccagtcgtcgagcagtctcgactagtactctcttagtaatctcattacttaat
atgcgtataatatacgcatctttattcctgcgtgtgccacttcagtactatttttatttg
gtcagaagaagaaataatggttcagtgcgaagtcgtcatctggtgccctgtggaggaggt
tccaatttttgccaaatgttttgccactttaaacagtggatattaaagagtttagacgta
ccaaaacatagaaggaaaactgggtcagtaactgtaaaccagttcaagattttggaaaaa
tatgatggacatcgaccaagaaagcatttggaaccaactttgtggattgacaagcaaatc
caagaccaaggttatgttgaaaaaatggtggttacagcttcacaatcaaaaggaactatg
gtagaaacacattccttaaattttcccgatgagggtagtgaggggccttcactctgcatt
gctgtcataggagctactggagaactggcaaaaggaaagatatttccagcattatttgct
ttgtattatagtggtttccttcctgaggatgtaggtatatttggttattcaagaaagaat
ttgacagacgaagaattgagatccattatagcatcaacattgacttgccgcattgatcat
caacaaaattgcgggaacaaaatggatgcttttcttagtagaacatatcatattaacgga
ggttttgacaacaaagatgggatgtcaaggctcaatgctcggatggagcaaattgaggga
ggatctgaagcaaacaggatattctacctttctgtgccacaagaagcccttctggatgtt
gcatgctctctttctgattatgctcaaacccagaaaggttggaatcgtataataattgag
aaaccttttggctttgatgccctgtcttctcagcagttaacaaagtctcttctttctaaa
tatgaggagaagcaaatatacagaattgatcatctactgggaaagaaccttattgaaaat
ctcacagttttaaggttttctaatcttgtctttgagccattatggagccgaacatacata
aggaatgtccaggtcattttatcagaagagttgggtgtgcagaggggaaggtattttgat
ggttatggtatcattcgagacatagttcatagccacatacttcagacaattgcattgctt
actatggaaccaccaataagtcttgatggtgaagatattcggaatgagaaagttaaggtt
ttaagatcaattcgcaaattgatacctggtgattttgttcttggacagtataaatctagt
tctagggacaaaattgatataaatttgaatagtttgactcccaccttctttgcttctgca
ttatacattgaaaatgcacgttgggatggtgtacctttcataatccaagctggtatgggt
ctcattaaacacagagtggagatacgtatacagtttcatcaagttcccggaaatctctac
cgtggatattttgggtctagtatggaccatgtagctaatgaactgattctaagtgatgtg
cctgatgaggctattttggttaaggtgaataacaaggttccaggtttaggcatgcagctg
gatgcttcagaacttaatttgctgtacaaggacaggtacaatgttgagatacctgattct
tacgagcatcttcttctcgacgttattgatggggacaaccatcttttcatgagaagcgat
gagcttgctgctgcatggaatattcttactccagttctgcaggagatagacaagaaaaat
attgcaccagaagtttatgaggttggaggtagaggtccaattggagcgtactatcttctg
gcaaaacatggggttcgttgggtggatgattaa

DBGET integrated database retrieval system