KEGG   Carica papaya (papaya): 110815967Help
Entry
110815967         CDS       T05151                                 

Definition
(RefSeq) cold-responsive protein kinase 1
Organism
cpap  Carica papaya (papaya)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Bac_DnaA
Motif
Other DBs
NCBI-GeneID: 110815967
NCBI-ProteinID: XP_021899645
Position
Unknown
AA seq 419 aa AA seqDB search
MGCFSFVFHKRPASSMNDSFDCNEEISGISNVKIYTYKELKTATNDFSPTNKIGEGGFGF
VYKGCLKDGKIAAIKVLAAESRQGVKEFLTEINVISEIEHENLVKLFGCCVEGHHRILVY
NYLENNSLAQTLLGAGHSGIQFDWRTRSRICVGVACGLAFLHEEVRPHIIHRDIKASNIL
LDKDLTAKISDFGLAKLIPADMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGVLLM
EIVSGRCNTNTRLPIDQQYLLERTWDLYERKELVELVDTSLNGDFDAEEACRFLKIGLLC
TQDSPKLRPSMSSVVKMLRGKKDIDDEKITKPGLLSDFMDLKVRNGQKPAETKTTSSYNM
SSGSDNLDNSSSGTSAWQTMSSATAIYDRSILNSKVKELSPSNLFLFYSSFGFWSFLFV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggttgcttttctttcgtattccataagaggccagcctcatcaatgaacgattctttt
gattgtaatgaagaaatttcaggaattagcaatgttaaaatatacacatacaaagagtta
aaaactgccaccaatgattttagtcccaccaataaaattggggagggaggcttcggtttt
gtttacaagggatgtctcaaagatgggaaaattgcagccataaaagttctagcagctgaa
tcaagacagggagtcaaggaatttttgacagagattaatgtgatctcagaaatagagcat
gaaaatttagtaaaactttttgggtgttgtgtggaaggccatcatagaatcctggtctac
aactaccttgagaataatagccttgctcagactcttcttggtgcaggtcacagtggtata
cagtttgattggcgcactcggtctaggatttgtgttggggttgcatgtgggctcgccttc
cttcacgaggaagtacggccacacattattcatagagacataaaagcaagcaatattctg
cttgataaagacttaactgccaaaatttcagattttggtcttgcaaagcttatcccagca
gacatgactcatgttagcactcgagtggctggaacaataggttatctggctccagagtat
gcaatcaggggccaattgacacggaaagcagatatttacagttttggggtcctccttatg
gaaatagttagtggaagatgtaacacaaatacacggttgccaattgatcagcagtatctt
cttgagcggacatgggatctgtacgagagaaaggagcttgtggagctggtcgacacatct
ttgaatggagattttgatgctgaagaggcttgtagattcctaaaaattggtcttctgtgc
acccaagattctccaaaacttcgaccatctatgtcaagtgttgtcaagatgctgagaggc
aagaaggacattgacgatgaaaagatcacaaagccagggttactatctgattttatggac
ctcaaagtgcgaaatggacaaaaaccggctgaaacaaagactacatcttcctataacatg
tcatctgggtcagacaacctggacaattcgtcttcaggaacctcagcctggcaaactatg
agttctgcaactgcaatatatgataggagcattttaaacagcaaggtaaaagaattaagt
ccatctaatttatttttattctactctagttttgggttttggagcttcctatttgtgtaa

DBGET integrated database retrieval system