KEGG   Carica papaya (papaya): 110817264Help
Entry
110817264         CDS       T05151                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00250  Alanine, aspartate and glutamate metabolism
cpap00650  Butanoate metabolism
cpap01100  Metabolic pathways
Module
cpap_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110817264
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110817264
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     110817264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110817264
NCBI-ProteinID: XP_021901414
Position
Unknown
AA seq 481 aa AA seqDB search
MTLGVTAIMARRLLYSHLPSMHASKLLLSRQMSMEAQGVAGKLKSSGILRTQGLIGGKWI
DAYDKKTIKVNNPATGEIIADVPCMGGRETNNAISSAYDAFNSWSKLTATERSKCLRKWY
DLLIAHKEEIGQLITLEQGKPLKEAMGEVAYGASFIEFSAEEAKRIYGDIIPATLSDRRL
FVLKQPVGVVGAITPWNFPLAMITRKGAVNVVMGNAPEIGDALVASSQVRKITFTGSTAV
GKKLMAGAAGTVKKLSLELGGNAPCIVFDDADLDVAVKGALAAKFRNSGQTCVCANRVIV
QDGIYDKFADAFSKAVEKLQVGMALLYSLNYGLQVESFVEDAMSKGAKILLGGKRHSLGM
TFYEPTVIGDAKNEMLISREEVFGPVAPLLRFKTEEEAIQIANDTNAGLAAYLFTNNVQR
TWRVSEALEYGIIGVNEGLISTEVAPFGGVKQSGLGREGSKYGMDEYLELKYVCLGDMNR
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgggagtgacagcaatcatggctcggaggctcttgtattcacatttaccttcc
atgcacgcatctaagcttcttctctctcgccagatgagcatggaggctcaaggagttgct
ggtaagctcaagagttctggtatattgcgaactcaaggtctaataggaggaaaatggatc
gatgcatatgataagaagactatcaaggttaacaatccagcgactggtgaaatcatagct
gatgtcccatgcatggggggaagggagaccaataatgctatatcatcagcgtatgatgcc
tttaattcttggagtaaacttacagctactgagaggagcaaatgcctgaggaagtggtat
gacctactaattgcacacaaagaagagattggacaactaataaccttagaacaaggaaaa
cctttgaaagaggccatgggtgaggttgcctatggggccagttttattgagttctctgcg
gaggaggcaaaacgtatatatggggatataattccagcgactttatctgatcgtcggttg
tttgtactaaagcagcctgtaggagttgttggtgccattacaccttggaactttccgttg
gcaatgattactcggaagggtgctgtaaatgtggttatgggaaatgctcctgaaattggg
gatgctttagttgcaagttcacaggtaagaaagatcacattcaccggatcaactgcagtt
gggaagaagttgatggcaggggctgcagggactgttaagaagttatctcttgaacttggt
ggaaatgcaccctgcatagtctttgatgatgcagatttggatgtggctgtaaaaggagcg
ctggcagcgaagttccgcaatagtgggcagacatgtgtttgcgccaaccgagtgattgtg
caagatggtatctatgacaaatttgcagatgctttttcaaaagcagtagagaaactgcaa
gtagggatggctttactgtattcccttaactatggtttgcaggttgaatcattcgtcgaa
gatgctatgtcaaagggagcaaaaatccttcttggtggtaaaagacatagccttggaatg
acattttatgagcctactgttattggtgatgccaagaatgagatgcttatttctagagag
gaggtgtttggacctgtggcacctcttttgcggtttaaaactgaggaggaagcaattcag
attgctaatgacacaaatgcagggttagctgcatacctatttacaaacaatgttcaacgt
acatggcgtgtctctgaggctcttgaatatggaattattggtgtaaatgaagggctaatt
tcaacagaggttgctccatttggaggtgtcaaacaatccggtcttggaagggaaggatcc
aaatatgggatggatgaatatctagaattaaaatacgtatgcttgggggatatgaacaga
aaatag

DBGET integrated database retrieval system