KEGG   Carica papaya (papaya): 110817916Help
Entry
110817916         CDS       T05151                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110817916
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     110817916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 p25-alpha EF-hand_8 LysR_substrate
Motif
Other DBs
NCBI-GeneID: 110817916
NCBI-ProteinID: XP_021902326
Position
Unknown
AA seq 588 aa AA seqDB search
MRSFSFFQKVSRAFHDYPSLSHLIVVSTVSGGSLIAYSDAAYSDSNTPTGRHVVAADEGE
TKKRKVVVLGSGWAGTSFLRNLNSPSYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP
IRNIVKKKNVDVSYWEAECVKIDEQNKKVYCQSKQGMDSNGKKEFAVDYDYLIIAIGAQS
NTFNIPGVEENCHFLKEVEDAQEIRRTVIDSFEKASLPELSDDERKKILHFVVVGGGPTG
VEFAAELHDFVNEDLVNLYPMVKDLARITILEAADHILSMFDKRITDFAEQKFKRDGIDV
KLGSMVVKVTDKEISAKTKGNGELSSIPYGMIVWSTGIGTRPVIKDFMKQIGQGSRRVLA
TDEWLRVEGTDSIYALGDCATINQRRVMEDISAIFSKADKDKSGTLTVKEFQEVIDDICE
RYPQVELYLKNKPMRDITDLLKEAKGDVAKESIELNIEEFKSALSQVDYEMKHLPATAQV
AAQQGVYLARCFNRMEECEKNPEGPLRFRGEGRHRFHPFRYKHLGQFAPLGGEQTAAQLP
GDWISIGRSTQWLWYSVYASKQVSWRTRALVISDWTRRFIFGRDSSRI
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagaagttttagcttcttccagaaggtttctagagctttccacgattatccttcgctt
tcgcatctaattgtcgtctccactgtcagtggtgggagccttatagcttattcagatgca
gcttattcagattcaaatacacctactggccgccatgtggttgctgctgatgaaggtgaa
accaagaaaaggaaggttgtggtgcttggaagtggctgggctggaactagtttcttgagg
aacttaaacagtccttcatatgaagttcaggttatatcacctcgtaattactttgcattc
acccctttgctgcctagtgttacatgtggtacagtggaagctcgaagcattgttgaacca
attcggaacattgtcaagaagaaaaatgttgatgttagttactgggaagctgagtgtgtc
aagattgatgaacagaacaagaaagtttattgtcaatctaagcaaggcatggattcgaat
gggaaaaaagaatttgctgtggactatgattatcttatcattgcaattggagctcagtct
aacacattcaatattcctggcgtggaggagaattgccatttcttaaaggaagttgaagat
gcacaggaaattcgtagaactgttattgattcttttgagaaggcaagcttaccagaacta
agtgatgacgagagaaagaagattcttcatttcgtggttgttgggggaggcccgacaggc
gtggagtttgctgcagagcttcatgattttgtcaatgaggatttggttaacctctatccg
atggttaaggatttagctaggataacaattctcgaggcagctgatcatattttgagcatg
tttgacaaaagaatcacagattttgctgaacagaagttcaaaagagatggtattgacgtg
aagttaggctccatggtggttaaggtgactgataaggaaatttctgctaaaacgaaagga
aatggggagctatcttctataccatacggaatgattgtctggtcaactggtattggaacc
cgcccagtaattaaagattttatgaagcaaattggtcaggggagtagacgggttttagca
actgacgaatggctacgagtagaaggaactgatagcatttatgcacttggcgactgtgca
acaattaaccaacgcagagtcatggaagatatttccgcaatatttagcaaggcagacaaa
gacaagtctggaacactcacggtgaaagagtttcaagaagtcattgatgatatttgtgaa
agataccctcaagtggagctttacttgaagaacaagcccatgagggatatcactgatctt
ttaaaggaagcaaaaggggatgttgcaaaagaatctattgagttgaacatcgaagaattt
aaatcagctctttctcaagttgattatgagatgaagcatcttccagccacagcacaggtt
gcagctcagcaaggtgtctaccttgctagatgtttcaaccgaatggaggagtgtgaaaaa
aatccggaaggtcctttaaggttcaggggagaaggtcgccatcggtttcatcccttcagg
tacaagcatcttggacaatttgctccattaggaggagagcaaacagcagcgcagcttcct
ggagattggatttcgattggccgcagtacgcagtggctttggtattctgtctatgcgagc
aagcaagtgagctggcgcacaagagcattagtgatctcagattggacaaggcgttttatc
ttcgggagggattcaagtcgaatttga

DBGET integrated database retrieval system