KEGG   Carica papaya (papaya): 110818072Help
Entry
110818072         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110818072
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpap03041]
    110818072
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110818072
Spliceosome [BR:cpap03041]
 Complex C
  Other components
   Step II factors
    110818072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind S1 Helicase_C HA2 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD Sigma54_activ_2 DUF2075 DUF5110 AAA_14 PhoH AAA_16 ABC_tran AAA
Motif
Other DBs
NCBI-GeneID: 110818072
NCBI-ProteinID: XP_021902522
Position
Unknown
AA seq 955 aa AA seqDB search
HERQRESRTRDRRRGRDRGRERERDGDSSYRNRDRHRDRYDRLDRHRDRNYDGDYDRRRD
KDRDRHRHRRDGHEENGDRRESDKDEDRGSNRRHISNEPELYKVYKGRVSRVMDTGCFVQ
LNDLRGKEGLVHVSQIATRRISNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQETGKD
LLPLKRSSDDDAFRTNPSGSKEGPVATTGLSGISIMEENNTVPSRRPLKRMSSPERWEAK
QLIASGVLRVDEYPMYEDDGDGLLYQEEGAEEELEIELNEDEPAFLHGQTRYSVDMSPVK
IFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQ
ELRGVGLSAYDMPEWKKDAFGKALTFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVL
VVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGY
AIRFEDCTGPDTVIKYMTDGMLLREILIDESLSQYSVIMLDEAHERTIHTDVLFGLLKHL
VKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITV
LQIHLTEPEGDVLLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRI
FEPAPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASA
KQRAGRAGRTGPGKCYRLYTESAYRNEMSPTTIPEIQRINLGHITLNMKAMGINDLLSFD
FMDPPAPQALISAMEQLYSLGALDEEGLLTKLGXKMAEFPLEPPLYKLDVVSAGKNFTKI
RKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMR
EVTVIDPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
catgagcggcaaagagagagcaggacgagagataggcgtagaggtagagacagaggcagg
gaaagagaaagagacggagacagcagttataggaatagggacagacatagagatagatat
gatagattagatcggcacagagaccggaactatgacggggattatgataggagaagggat
aaggacagggataggcataggcatagaagagatggacatgaggagaatggagatagaagg
gagtctgacaaagatgaggatcgagggagcaataggcggcacatatcaaatgaacccgaa
ctatacaaagtgtacaaagggagggtgtcaagagtgatggacacaggctgcttcgtgcaa
ttgaacgatttgagagggaaggagggtctggtgcatgtctcgcagattgctactaggagg
attagtaatgctaaagatgttgtgaagcgggatcaggaggtctatgtgaaggtgatttct
gtttcgggtcagaaattgagtctttctatgagggacgttgatcaggagactggcaaggat
ttacttcctctgaagaggagctcagatgatgatgcctttaggactaatccttcagggtcc
aaggaggggccagtggctacaactgggctttcagggatttcgattatggaggaaaacaat
actgttccatcacgcaggccattgaagagaatgagttcgcccgagagatgggaggcgaag
cagttgattgcctctggtgtcttgagggtggatgagtatccaatgtatgaggatgatgga
gatggattgctctatcaagaagagggtgctgaggaggagcttgagattgagttgaatgaa
gatgagcctgcatttttgcacgggcaaaccagatattctgttgatatgtcaccagtgaag
atattcaaaaatcctgaaggttcgttgagtcgtgcagctgcacttcaatctgcactcata
aaggagaggagggaagtgcgagaacagcagcagagaaccatgctcgattcaattccaaaa
gatcttaatcgaccatgggaggacccaatgccagaaactggtgagaggcatcttgcacag
gagcttagaggtgttggcttgtcagcttatgatatgcccgaatggaagaaagatgcattt
ggaaaagctctaacttttgggcagagatcaaagctctccatccaggagcagaggcagagc
ttgcctatttacaaattaaaaaaggagttgatacaggccgtgcatgataaccaagtcctg
gttgtcattggtgagacaggctccggaaagactacacaggtgacacagtaccttgcagaa
gcaggctacaccacaagaggtaagattggttgtactcagccacgtagggtagcagcaatg
tctgttgctaagagagttgcagaggagttcggttgtcgcttgggggaagaagttgggtat
gcaattcggtttgaagattgcactggaccagatactgtgatcaagtacatgactgatggt
atgcttcttagggagattcttattgatgagagcctctctcagtactctgttatcatgctt
gatgaagctcatgagagaacaattcacactgatgtcctttttggattgcttaaacatctt
gtaaaaaggagacctgaccttcgattgattgtcacctcagctacattagatgctgagaag
ttctcagggtactttttcaattgtaatattttcacaatccccggaagaacttttcctgtt
gagatactttataccaagcagccagaaagtgactacttagatgctgctctgattactgtc
ctacagattcacttgacagagcctgaaggtgatgtcctcctcttcttgactggtcaggaa
gagattgattttgcatgccagtctctttatgagaggatgaaaggactgggtaaaaacgtt
cctgagcttattattttgccagtatatagtgctcttcctagtgaaatgcaatctaggatt
tttgaacctgcccctccaggaaagaggaaagtggttgtggcaacaaatattgctgaagca
tctttgacaattgatgggatatactacgtcgttgatcctggttttgcaaagcaaaatgtt
tataacccaaagcaagggctagaatcattggtgataactcccatttcacaagcatcagcc
aagcaacgggctgggcgtgctggccgcacagggcctgggaaatgttaccgtctatatact
gagagtgcataccgcaatgagatgtccccaacaacaattccagaaatccaaaggatcaat
cttggacatattactctcaacatgaaggccatgggtataaatgatctcttgtcttttgat
tttatggatccgcctgcccctcaagccctgatttctgccatggaacagttatacagtctt
ggagctctggatgaggagggcctcttgactaaattgggtnagaaaatggcagaatttcct
ctggagccaccactgtataaattggatgttgtgagtgcaggaaagaatttcaccaagatt
aggaaggcaatcacagcaggattcttttttcatgctgctagaaaggaccctcaagaaggc
tataggacgctagttgagaaccagccagtgtacattcaccccagcagtgcacttttccag
agacaaccggactgggtcatttaccatgagctggtaatgaccaccaaagagtacatgcga
gaggtaacagttattgatcctaagtggcttgtggaattggctccaagattcttcaaagta
gcagatcctaccaaaatgagtaagcgcaagcgtcaagaacgtattgagccactctatgat
agataccatgaacctaattcttggcgtttgagcaaacgacgtgcatga

DBGET integrated database retrieval system