KEGG   Carica papaya (papaya): 110818235Help
Entry
110818235         CDS       T05151                                 

Definition
(RefSeq) uncharacterized protein LOC110818235
  KO
K06195  ApaG protein
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    110818235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-GeneID: 110818235
NCBI-ProteinID: XP_021902717
Position
Unknown
AA seq 302 aa AA seqDB search
MHSLTFKGFTDFNTGTRISWPGRENSGCVGLEVARTRVGLGWRDLTRNCRIMACALERDE
GGGTGRESPSSGSRSDFGTGLNMSASSFLSRSQTYATLKQQMEVAARAEDYKEAARIRDS
LKSFEEEEPVLQLRRLMREAVIDERFEDAAKYRDELKEIAPHTLLKCSSDATTLGIRIQV
RSVYIEGRSQPLKGQYFFAYRIRITNNSDRPVQLLRRHWIITDANGKTENVWGIGVIGEQ
PVILPKTGFEYSSACPLSTPNGRMEGDFEMKHIDKIGTQTFNVVIAPFSLSTLGDEVDFY
EV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcattccctgacgtttaaaggtttcactgattttaacacggggacgagaatctcttgg
ccaggtcgagaaaatagcggttgcgttgggttggaggtagcgaggacgcgggttggactg
ggttggagggatctcaccaggaactgtaggattatggcctgtgcgttggagagggacgaa
ggtggtggcactggaagggaaagccctagttcgggatcgcgttcggacttcggtacgggt
ttgaacatgagtgctagttcgttcctgtcgcggagccaaacttatgctacgttgaagcag
cagatggaggtcgccgccagagcggaggattacaaagaagcagcaagaattcgtgattct
ttgaaatcatttgaagaggaagagccagttctacaacttcgccgcttgatgagagaggcc
gtgattgatgagaggtttgaggatgctgcgaagtatcgcgatgagctaaaggaaattgca
ccacacactctcttgaagtgttcaagtgatgcaacaactttgggcatcaggattcaagtt
aggagtgtttatattgaaggccgtagccaacctctaaaggggcaatacttttttgcatat
agaataagaatcaccaataactctgatcgtcctgttcaacttctcagaagacattggatt
attactgatgcaaatggaaagactgagaatgtgtggggaatcggagtcataggtgaacag
cctgttatacttccaaagacaggttttgaatactcgtctgcctgtccattgagcactccc
aatggcagaatggaaggtgactttgagatgaaacacattgataagattgggacacagact
ttcaatgtggtaattgctccattttctctctctacactgggagatgaggttgatttctat
gaagtataa

DBGET integrated database retrieval system