KEGG   Carica papaya (papaya): 110819153Help
Entry
110819153         CDS       T05151                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00010  Glycolysis / Gluconeogenesis
cpap00562  Inositol phosphate metabolism
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110819153
   00562 Inositol phosphate metabolism
    110819153
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110819153
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110819153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110819153
NCBI-ProteinID: XP_021903931
Position
Unknown
AA seq 500 aa AA seqDB search
MKKVMRMSPILIFFFFLSPMLMQSRADQDFDVRQHLSTVSRYGVMKNVAPSSFIPSKIPD
GCNPIHLNLIARHGTRSPTKKRMRELERLALHIKELIRDVEKKRSSLEKLPAWLREWESP
WKGKLKGGELVSKGEEELYQLGKRIRERFPGLFSDEYHPDVYPIKATQVPRASASAVAFG
MGLFSERGGLGPGKHRAFAVTSESRASDIKLRFFDCCESYKSFRKNHEPAVDKLKEPILD
EITSALTKKFQLNFTRQDTSSLWFLCKQEASLLDITDQACGLFSPDEVALLEWADDLEVF
ILKGYGTSLNYRMGVPLLKDVIQSMEEAIKAKEENLVPGSYEKARLRFAHAETVVPFSCL
LGLFLEGSEFQRIQKEQPLELPPKPPKKRNWRGSTVAPFGGNNMLVLYSCPANSSSEYFV
QVLHNEHPIPVPGCNQSDICPFEVFKERIATPHMRHDYNTLCSIKPEEQKQKPVISKLSP
LFRWFFPTWNDDSPVQKAEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttatgcgtatgtctccgattctaatcttcttcttcttcttgtctcctatg
ttaatgcaatcaagagccgatcaagacttcgatgttcgccaacacctatcaactgtctca
agatatggtgtaatgaaaaatgttgctcccagttcctttataccatctaaaattccggat
gggtgtaatcctatccacttaaaccttattgcaagacatggcactcgttctccaaccaaa
aaaaggatgagagagttagagagattggctcttcatataaaagaactgattagagatgtg
gaaaagaagagatcgtctttggaaaaacttcctgcttggttaagggaatgggaatctcca
tggaaaggaaaattgaagggtggggaattggttagcaaaggggaagaggagctctatcaa
cttgggaaaaggatcagagaacgatttcctggtctgtttagtgacgaataccacccagat
gtttatcccataaaggctacacaggttcctcgggcatctgctagtgctgtggcatttggt
atggggctgtttagtgagagaggaggtctagggccgggaaagcatcgggcttttgctgtt
acaagtgaaagccgtgcaagtgatataaaactgaggttttttgattgttgtgaaagctac
aagtcgtttaggaagaatcacgagcctgcagttgataagcttaaggaacctatcctggat
gaaataacatcagcattaaccaaaaaatttcagctgaacttcacaagacaggatacttct
tctctatggtttttatgcaaacaggaagcatccttattggatattactgatcaagcttgt
gggctcttcagtcctgatgaggttgctttgctggagtgggcagatgacttggaggtgttt
atactaaagggttatggtacatcactaaactacagaatgggagtgccacttcttaaagat
gttatacaatcaatggaagaagcaatcaaggctaaagaagaaaatcttgttcctggaagt
tatgagaaggcgaggcttaggtttgcacatgcagaaactgtggttccattttcgtgtctt
cttggtcttttccttgaaggatctgaattccaaagaatacagaaggaacaacctctggaa
ctccctccaaagcctcccaagaaaagaaattggaggggcagcactgtggcaccttttggt
gggaataacatgctggttctatacagttgcccagctaattcttcaagtgagtacttcgtg
caagttctgcacaatgaacatcccatcccagtgccgggctgtaatcaaagtgatatttgt
cctttcgaagttttcaaggaaagaatagcaactcctcacatgaggcatgactacaataca
ctctgcagtattaagcctgaagaacaaaaacagaaacctgtgatcagtaagttatcacca
ctgttccgttggttcttcccgacctggaatgatgattctccagtgcaaaaagctgaatta
tag

DBGET integrated database retrieval system