KEGG   Carica papaya (papaya): 110819749
Entry
110819749         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00100  Steroid biosynthesis
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110819749
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110819749
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110819749
NCBI-ProteinID: XP_021904757
Position
Unknown
AA seq 384 aa
MLQSDSHKDRMDLDFLLHALVPTWNSVAILAVFFTYLAIVGSILPGKIVPGVLLSDGTRL
RYRCNGLVSLLLLVTLLGVGAKMDFISPAMIADRGLELLSTTFLFSFLATLMLYIAGCKS
SSQSSSLKPHLTGNLIDDWWFGIQLNPCFMGIDLKXVVSPFFSGPLXSMXXIIPFLCTLA
VXLISGSLSQSMILYQIFCALYVLDYFAHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTF
SIQGWWLLGNKVELTTVASIANCFVFLIGYMVFRGANKQKHLFKKNPKALIWGKPPKVVG
GKLLASGYWGIARHCNYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARC
AEKYREIWKEYRRLVPWRILPYVY
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgttacaaagtgactcgcataaagatagaatggatctagattttcttctacacgcctta
gtgcctacttggaactctgtagctatattagctgtgttcttcacttatttggcgatcgtt
ggatctattctaccgggtaaaattgtccccggggttctcttgtccgatggcactcgcctt
cgttatcgctgtaatggattggtttcacttctattgctggttacgcttctcggggtcggt
gctaagatggatttcatatcgcctgctatgatagcagatagagggcttgagctgctgtca
acaacttttttattcagttttctggcaacattgatgctctatattgctggttgcaagtcc
tccagtcaaagttcctctctgaagcctcatttaacaggaaacctgatagatgattggtgg
tttgggatacaactcaatccttgttttatgggcattgatctcaagtaagtggtctcgcct
ttcttttctggacctttgtgaagtatgtaataaattattccatttctctgcacattagct
gtgtagcttataagtggctccttaagccagtcgatgattctttaccaaatattctgtgcg
ctctatgtcctggattacttcgctcacgaggagtacatgacctctacatgggacataatt
gcagaaagattaggtttcatgttggtgtttggagatctagtgtggattcctttcactttt
agcatccagggttggtggcttttaggaaacaaggtggagctgacgacggttgcatcgata
gcaaattgctttgtctttctaattggatacatggtttttagaggagctaataaacagaaa
catttgttcaagaaaaatccaaaagcacttatatggggcaaacctccaaaggttgttgga
ggaaagttgcttgcatctggttattggggaattgcgcggcactgtaactacctcggggac
ctgctgctagctctctccttcagtttgccttgtggaataagctccccagttccttacttc
taccctatctatcttcttattctgttgatatggagagaacgaagagacgaagctcgctgt
gcggagaagtacagagaaatttggaaggagtaccgcagacttgttccttggagaatttta
ccatatgtttactag

DBGET integrated database retrieval system