KEGG   Carica papaya (papaya): 110820430Help
Entry
110820430         CDS       T05151                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 51
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpap03041]
    110820430
   03009 Ribosome biogenesis [BR:cpap03009]
    110820430
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110820430
Spliceosome [BR:cpap03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    110820430
Ribosome biogenesis [BR:cpap03009]
 Eukaryotic type
  90S particles
   Helicases
    110820430
  Pre-60S particles
    110820430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217
Motif
Other DBs
NCBI-GeneID: 110820430
NCBI-ProteinID: XP_021905586
Position
Unknown
AA seq 594 aa AA seqDB search
MEQVVNSLEEEKKRNRKRNRAKKLDQENSNGNVEKDEVEENKICDKEDKKMKKKKQNKKV
KREERVDGEAEEERQKEEKEEEAVGEEKDEQETKAMQRGSGIMSTESFESLGLSEHTFRS
IKEIGFLHMTQIQARAIPPLMIGKDVLGAARTGSGKTLAFLIPAIELLYNVHFTPRNGTG
VIVICPTRELAIQTHAVAKDLLKYHSQTLGLVIGGSARRGEAERIVKGVNLLVATPGRLL
DHLQNTKGFIYKNLKCLMIDEADRILEANFEEEMKQIIKLLPKNRQTALFSATQTKKVED
LARLSFQTTPIYIDVDDGRRKVTNEGLQQGYCVVPSSKRFILLYSFLRRNQSKKVMVFFS
SCNSVKFHAELLRYIKVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPA
VDWIVQYDPPDEPKEYIHRVGRTARGEGARGNALLFLIPEELQFLRYLKAAKVPVKEYEF
DDKKLANVQSHLEKLVANNYYLNKSAKDAYRSYILAYNSHSMKDIFNVHRLDLQAVAASF
CFSCPPKVNLTIDSSASKFRKKIRKTEGSRNGFSESNPYGRQKVEDDTRQFVRF
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagtagtcaacagcctggaggaggagaagaagaggaaccggaaacgaaacagg
gcaaagaaattggaccaggaaaattctaacggcaatgttgagaaagatgaagtggaagaa
aataagatctgtgacaaggaggataagaagatgaagaaaaagaagcagaataagaaagtg
aagagggaggagagagtggatggtgaggcagaggaagagaggcaaaaggaagagaaggaa
gaggaagctgtaggggaagagaaggatgaacaagaaactaaagctatgcagagagggagt
gggataatgagtactgagtcatttgagtcactgggattatctgagcatacttttaggtcc
atcaaagagatcggttttttgcatatgactcagatccaagccagagcaatcccaccactt
atgattggcaaagatgtccttggagctgcaagaacaggatctgggaaaacacttgctttt
ctaataccagctattgagttattatataatgttcatttcactcctcgcaatggtacaggt
gttattgtcatttgccctacaagagaacttgctattcagactcatgctgtcgcaaaggac
cttctcaagtaccactcgcagactcttggcttggtcattggtggttcagcgagaagagga
gaagcagaacgtattgtgaaaggagtaaatttattagtggcaactcctggtcgacttctt
gatcatcttcaaaatactaagggatttatatataaaaacctgaagtgccttatgattgat
gaagcagatagaatattggaagcaaactttgaagaagaaatgaaacaaattatcaagctt
cttcctaagaataggcaaactgctttgttttcagctactcagacaaagaaggttgaggat
cttgcacgcttgtcattccagacaacccctatttatattgatgtggatgatggaagacgc
aaggtgaccaatgaaggactgcaacaaggctactgtgttgtgcccagtagcaagagattt
attcttctatattccttcttaaggaggaatcagtcaaagaaagtgatggtattcttctct
tcatgtaactcagtcaagttccacgccgaactccttagatacattaaggtggattgcttt
gatattcatggaaagcaaaagcagcagaaacgtaccacaacgttctttgacttctgcaaa
gcagaaaaaggaattttgttatgtactgatgttgctgctcgaggacttgatattcctgct
gtggactggattgttcaatatgatcctcctgatgaacccaaggaatatattcatagggtt
ggtcggacagcccgtggagaaggagcaagaggaaatgccctactcttcctgattccagaa
gagttgcaattccttcgttacctgaaggcagcaaaagttcctgttaaagagtatgaattt
gatgacaaaaaattggcaaatgttcagtctcatttggagaagttggtagccaacaactat
tatttgaataaatcagctaaagatgcatatagatcctacatattggcatataactcgcac
tctatgaaggacatttttaatgttcaccgcctagatcttcaggctgttgctgcttcattt
tgcttttcttgccctccgaaagtgaacctgaccattgacagtagtgcttccaaatttaga
aagaaaatccggaagacagaaggaagtcgaaatggattcagcgaaagcaatccttatgga
agacagaaggtcgaggatgatactcgacaatttgttaggttttag

DBGET integrated database retrieval system