KEGG   Carica papaya (papaya): 110820697Help
Entry
110820697         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110820697
Enzymes [BR:cpap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110820697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Terminase_4
Motif
Other DBs
NCBI-GeneID: 110820697
NCBI-ProteinID: XP_021905965
Position
Unknown
AA seq 325 aa AA seqDB search
MLILVVDKPLREKLVLIDIIQHLGVTYPFKNETNEILKQIYETQFDLDTINDDILELYEA
SYSRVHGEDILEKVTSNQGLKPTDLQGITLPRLEAKRYISIYQKDVSHNKILLHFAKLDF
NYLQSLYKKELKFLYRYWKDKHITTKLPFVRDQVVECYLWILGGFXEPQLSSLKIIMTKL
VFMIVIIDDMYDAYGTFEELKHFTDAIERFWDMKTVDNLRDYMKLCYKLVFELYEEIEKE
IIKRGTIYRIQYVKQKWFNENNIPLIEEYMLITMHSTAYHLFLTVAFVVIEDTVTKDMFD
WVASKPKIVIAATLIAKFMGDICFS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttaattctcgtggttgacaagcctttacgggagaaactcgttttgatagatatcatc
caacacttgggtgtgacttacccttttaaaaacgagaccaatgaaatcttgaaacagatc
tatgagactcaatttgatcttgataccattaacgatgatatattagagctttacgaagct
tcatattcacgagtacatggagaagatatactagagaaagtcacaagtaaccaaggcctt
aaaccgaccgatttgcagggcattaccttaccaaggctagaagctaaaagatatatttct
atctatcaaaaagatgtttcacataataaaatacttctacactttgctaaattggatttc
aattacttgcaatctctttataagaaagagctcaaatttctataccggtattggaaggac
aaacatattacaactaaactaccatttgtacgagatcaagtagtggaatgttacttatgg
atattaggaggattttaagaacctcaattatcttctctgaaaattataatgactaaatta
gttttcatgatagtaataattgatgatatgtatgatgcatatggaacatttgaagagctt
aaacattttaccgatgcaattgaaaggttctgggatatgaaaactgtagataatctccga
gactatatgaaactatgctataaattagtttttgaattatatgaggaaattgaaaaggag
atcatcaaaagaggaaccatatatcgaattcaatatgtaaaacaaaagtggttcaatgaa
aataatataccactaatcgaagagtacatgctgattacaatgcattcaactgcatatcac
ttgttcttgactgttgcttttgtagttatagaagatactgtaacaaaagacatgtttgac
tgggttgctagcaagccaaagattgtgatagcagcaacacttattgccaaattcatgggc
gatatttgtttttcataa

DBGET integrated database retrieval system