KEGG   Carica papaya (papaya): 110822619Help
Entry
110822619         CDS       T05151                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
cpap  Carica papaya (papaya)
Pathway
cpap03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110822619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cpap03012]
    110822619
Translation factors [BR:cpap03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    110822619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI La_HTH_kDCL
Motif
Other DBs
NCBI-GeneID: 110822619
NCBI-ProteinID: XP_021908457
Position
Unknown
AA seq 921 aa AA seqDB search
MASRFWTQGSSDSEEELSDHEEEIDDVPGGESSAQTTTNRYLQVNASDSDDSDGQKRVVR
SAKDKRFEEMSATIDQMKNSMKINDWVSLQDCFDKLNKQLEKVMRVTESERVPTLYIKAL
VMLEDFLSQALANKDAKKKMSSSNAKALNSMKQKLKKNNKQYEDLINKYRENPESEEDRD
RGEESEEEEESESEFEEDYTNIVTRSESGDEEEDEEVDDKDDRAWEKKLSKKDKLMDKQF
MKDPSEITWEIVNKKFKEVVAARGRKGTGRFEQVEQLTFLTKVAKTPAQKLEILFSVISA
QFDVNPGLSGHMPISVWKKCVQNMFVILDILVQFPNIVVDDMVEPEENETQKGADYNGKI
RVWGNLVAFLERIDVEFFKSLQCIDPYTREYVERLRDEPMFLVLAQDVQNYLERIGDYKS
AAKVALRSVELIYYKPQEVYGAMSKLAEQTEEVDNGGEEPKVVEESRGPSPFIVIPEVVP
RKPTFPESSRALMDDLVSLIYKCGDERTRARAMLCDIYHHALLDEFSTARDLLLMSHLQD
NIQHMDISTQILFNRAMAQVGLCAFRVGLIVEAQSCLSELYSTGRVRELLAQGVSQSRYH
EKTPEQERLERRRQMPYHMHINLELLEAVHLICAMLLEVPNMASNNLDAKRKVISKTFRR
LLEVNDRQTFTGPPENVKDHVVAATRALGKGDFQKAFDVINSLDVWKLLRNRESVLDMVK
AKIKEEALRTYLFFYSSSYNSLSLDQLTKMFDLTDEQTHSIVSKMMINEELRGSWDQPTR
CIIFHDVQHSRLQALAFQLTDKLSILAESNERAIESRIGGGGLDLNLRRRDGQDYSGGMT
AGANKWQDLSFNQGRQGAGGRSGYNVGGGRQSGLGQHGAGYSRDRTGQRGAGGYSSRAAA
IRGSQADSSTRMVSLNRGIHA
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacgtttttggactcagggtagcagtgacagtgaggaagagttgagtgatcat
gaggaggaaattgatgatgtgccaggtggtgagtcctcagcccagaccacaacaaatagg
tatctgcaagtaaatgcaagtgacagtgatgattcagatggccaaaagcgggttgttagg
tcagctaaagacaagcgttttgaagagatgtcagccaccatagaccagatgaaaaattct
atgaagatcaatgactgggttagcctgcaggattgctttgacaagctaaataaacagctt
gagaaggtaatgcgcgttacagagtctgaaagggtccccactctttacattaaagctctt
gtgatgttagaagatttcttgagtcaagctttggcaaataaggatgcaaagaagaaaatg
agtagcagtaatgccaaggccttgaattcaatgaaacagaaactgaagaagaataacaag
cagtatgaggatttaattaataaatatagggagaaccctgagagtgaggaggacagggat
cgtggtgaggaatcggaggaggaagaagaatctgagtcagaatttgaggaggactacacg
aacatagttacaagatcggaatctggagatgaagaggaagatgaagaagtggatgacaag
gatgatcgtgcttgggagaagaagctgagcaagaaagataagctcatggataagcagttt
atgaaggatcccagtgaaatcacctgggaaattgttaacaagaagtttaaagaggttgtt
gctgctcggggaaggaaaggaactggaaggtttgagcaggttgaacagcttactttcttg
acaaaggttgccaagactcctgcacagaaacttgaaattttgtttagtgttatctctgca
cagtttgatgtgaatccagggctcagtggacatatgcctataagcgtgtggaagaagtgt
gtccaaaatatgtttgtcatactggacattcttgttcagtttccaaacattgtggtggat
gatatggttgaacctgaggagaatgaaacacaaaagggggcagattataatgggaagatt
cgagtttggggaaacttggttgcgttcctagaaaggatcgatgtggagtttttcaagagc
ttgcagtgtatagatccatacactcgtgagtatgtcgagagactgagggatgaacctatg
tttttggttcttgctcaagatgtccagaattatttagagcgaattggcgattataaatca
gctgcaaaggttgctttaaggagtgttgagctcatttattacaagccacaggaggtttat
ggtgccatgagtaaactggctgagcagacagaagaagtagataatggaggtgaggagccg
aaggtggttgaggaaagtaggggtccttctccatttattgttattcctgaggttgtacct
cgtaagccgacttttcctgaaagtagcagagcattgatggatgatttagtgtctcttata
tacaaatgcggtgatgagaggaccagagcccgtgcaatgctttgtgatatttaccaccat
gctcttctagatgagttttcaactgcgcgggacttgctgctgatgagtcatttgcaggac
aacatacaacatatggacatctcaacacaaattctttttaacagggctatggcccaggtc
ggtctttgtgcgtttcgcgttggtttaattgttgaagcacagagttgtctttctgaacta
tattccactggaagggttagggaattacttgctcaaggagtgtcacaaagtcgatatcat
gagaagactccagaacaggaaaggttggaaagaagacgccaaatgccttaccatatgcac
ataaatcttgaactactggaagctgttcatctaatctgtgccatgctgcttgaggttccc
aacatggcaagcaataaccttgatgcaaagcgaaaggtcataagtaagacttttcggcgg
ttgctggaagtaaatgacagacaaacatttactggtccccctgaaaatgtcaaggatcac
gtagtggctgccaccagggcccttggcaagggagacttccaaaaggcctttgatgttatc
aactctctagatgtttggaagcttctcagaaaccgagagagtgtcctcgatatggttaag
gccaagattaaggaagaggctttgaggacatatctgttcttttactcatcttcatacaac
tcactgagcttggatcaactcaccaagatgtttgacctcacggatgaacagacacacagc
attgtcagcaagatgatgatcaatgaagaactgcgcggaagttgggaccagccaactcgc
tgcatcatcttccacgacgtccagcatagcaggctgcaagctttggcattccagctgact
gacaagttatctatccttgcagaaagcaatgaaagagcaattgagtctaggatcggcggt
ggtggcttggatctgaatctgaggcgacgagatggccaagattacagtggagggatgact
gctggagctaacaagtggcaagacttgtctttcaatcaaggacggcagggagctggtggg
cgatcaggatataatgttggtggtggtagacaatctgggctaggccaacatggagctggg
tattcacgggatcggacaggtcagcgaggagcaggtggatattccagcagagctgctgca
attaggggttctcaggcagattcttccactcgaatggttagcctaaacaggggaattcac
gcttag

DBGET integrated database retrieval system