KEGG   Carica papaya (papaya): 110823012Help
Entry
110823012         CDS       T05151                                 

Definition
(RefSeq) beta-glucosidase 32-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00460  Cyanoamino acid metabolism
cpap00500  Starch and sucrose metabolism
cpap00940  Phenylpropanoid biosynthesis
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110823012
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110823012
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110823012
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     110823012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 110823012
NCBI-ProteinID: XP_021908972
Position
Unknown
AA seq 518 aa AA seqDB search
MAMATKTWSVLLGLIVLSISFLPRTETTSFNRYSFPDDFLFGTASSSYQFEGAIEEDGRT
ASIWDTFAHTFPERNNFSNGDVAVDFYHRYKSDIKLMKDLNMDVFRLSISWSRILPNGKL
EGGINEKGVKFYKSLIKELLHNGIEVSATLFHWDLPQTLEDEYGGLLDSQFVDDFRDFAR
TCFKEFGDKVKYWTTFNEPWVISFIGYENGRKAPGRCSKWVNNACEAGDSSIEPYITSHN
LLLAHAAAVQEFRQCYKCQKIGKIGIVLSPFWFEPHTNSLADKQAVKRSLDFMLGWHLDP
ITFGDYPESMKTYVGDRLPSFTEDQSKMLKSSYDYIGINYYGAIYAANVDNVDPNQISYS
TDVHAQWKRDRNGTLIGEETGMDYILVYPEGIKYILNYTKDNYNDPTIYITENGYPEFDN
GTLSLADAMNDAKKIDYHIDHLRNVLKAIRDYGVNVKGYFAWSLMDNFEWEFGYTVRFGL
YYVDFKNNLKRHPRNSALWFKEFLNRNNHESPNSNAEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctatggctactaagacctggtctgttctacttggactaatagtcttatcaattagc
ttcctccctcgtactgaaacaacttctttcaatcgttatagctttcctgatgattttctt
tttgggacagcctcatcatcttatcaatttgagggtgcaatagaggaagatggtagaacc
gcgagcatatgggatacctttgctcatacttttcctgaaagaaacaactttagcaatgga
gatgtagcagttgatttctatcaccgatacaagagtgatataaaattaatgaaggatttg
aatatggacgtattcagactctcaatttcatggtccaggatattaccaaatggaaaatta
gaaggtggaataaacgagaaaggggttaaattttataaaagcctcatcaaagagctcctc
cacaatggcatagaagtctctgcaactctatttcattgggatcttccccaaacccttgaa
gatgaatatggtggtcttctagactctcaatttgtggatgattttcgagattttgcaaga
acttgcttcaaagaatttggtgacaaagtgaaatattggacaacttttaacgaaccatgg
gttataagtttcattggctatgagaatggaagaaaagctcctggacgatgttcgaaatgg
gtgaataatgcatgtgaagcaggagactccagcatcgagccttatataacttcccataat
ctgctccttgcccatgcagctgctgtacaagagttcagacaatgttacaagtgtcaaaaa
attggcaagattgggattgtactttctcctttttggttcgaacctcataccaattctctt
gcggataaacaagcagtcaagcgatcccttgattttatgttaggctggcatcttgaccct
ataacatttggagactatccagagagcatgaagacttatgttggagatagattgccttct
tttactgaagatcaatccaaaatgctcaaaagttcttatgattatattggaataaattac
tatggagctatatatgctgctaatgtcgataacgttgatcctaaccaaattagttactcg
acggacgttcatgctcaatggaaaagggacagaaatggaactttgattggagaagagact
ggtatggactacatactagtatatccggagggtatcaaatatattttgaattacaccaaa
gacaattacaatgatccaacaatttatattacagagaatggatatcctgaatttgataat
ggtaccttgtctttggcggatgccatgaatgatgctaaaaaaatagattatcacatagat
catctcagaaatgttctgaaagctatccgtgattatggagttaatgtcaaaggctatttt
gcgtggtcattgatggataacttcgaatgggagtttggttatacagttagattcggcctc
tattatgtcgattttaaaaataacttaaaacgtcatcctaggaattctgcattatggttt
aaggaatttctgaatagaaataaccacgaaagcccgaatagtaatgcggaactttag

DBGET integrated database retrieval system