KEGG   Carica papaya (papaya): 110824109Help
Entry
110824109         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase BIK1-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpap01001]
    110824109
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110824109
Protein kinases [BR:cpap01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110824109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase HRCT1
Motif
Other DBs
NCBI-GeneID: 110824109
NCBI-ProteinID: XP_021910339
Position
Unknown
AA seq 410 aa AA seqDB search
MGSCLSSRVKAESPLHNGTDSRYDSPNGNGVSVLSSKVSSVSLSNRTEGEILKSSNLKSF
TFNELKTATRNFRPDSVLGEGGFGCVFKGWIDEHSFAATRPGTGLVIAVKRLNQEGFQGH
HEWLTEINYLGQLYHPNLVKLIGYCLEDEHRLLVYEFMPKGSLENHLFRRASYFQPLSWN
LRIKVAFGAAKGLAFLHSDEAKVIYRDFKTSXYLLDSNYNAKLSDFGLAKDGPTGDRSHV
STRVMGTYGYAAPEYMATGHLTAKSDVYSYGVVLLEMLSGKRALDRNRPSREQNLVEWAK
PYLTSKRKILQVLDSRIEGQYTLQQALKVASIAIQCLSNEPKLRPSMDQVVRVLEQIQDS
MNADLMRSDPVRKTNCQSRTGDKNHQRSANGVCIGKVAACSRPSASPLRT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttgccttagctccagagtcaaagctgagagtcctcttcacaatggaacagat
tcaagatatgatagcccaaatgggaacggcgtaagtgttttaagcagcaaggtgtcatca
gtctcgctctctaataggacagagggtgagatcttgaagtcatccaatttgaagagcttc
acctttaatgagctaaaaacagccactaggaacttccggccagatagtgtgttaggagaa
ggtggatttggttgtgtcttcaagggctggatcgatgagcattcatttgcagctactagg
cctggcactggcctggttatcgcagtgaagaggcttaatcaagaaggttttcagggtcac
catgaatggctgacagaaattaactacttggggcagctgtatcatcctaacctagtcaaa
ttgattggttactgcctagaggacgagcaccggctcttggtgtatgaatttatgccaaag
ggcagtttggagaaccatctgtttagaagagcttcttactttcaaccactttcctggaat
cttcggataaaggttgcctttggtgctgcaaagggactagcttttctgcatagcgatgag
gcaaaagtgatatatcgggatttcaaaacttcgnnatatctgcttgattcgaactacaac
gcaaagctatctgattttggtttggcgaaggatggaccaacgggtgatagaagtcatgtc
tctacaagggtcatggggacctatggctacgcagctcctgaatatatggccacaggtcac
ctaactgcaaaaagcgacgtgtacagttacggggttgttctactcgaaatgttatcaggc
aagcgagcacttgacagaaacaggccaagcagagaacaaaatttggttgaatgggcaaaa
ccttaccttaccagcaagcgaaaaatcttacaggtcttggactcccgtatcgagggccag
tacacactgcagcaagctctcaaggtggctagcatagctatccaatgcctgtcaaatgag
ccaaagctcaggccaagcatggatcaagtggtaagagtcttagagcaaatccaggactcc
atgaatgcagacttgatgcgatccgaccctgtccggaaaaccaactgccagtcaagaact
ggtgacaagaatcaccagagaagtgctaatggagtctgcattggaaaagttgcagcttgt
tctaggccctcggcttccccacttcgtacatag

DBGET integrated database retrieval system