KEGG   Carica papaya (papaya): 110824153Help
Entry
110824153         CDS       T05151                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110824153
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     110824153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 110824153
NCBI-ProteinID: XP_021910403
Position
Unknown
AA seq 120 aa AA seqDB search
MASANSVRVAAAQMTSINDLAANFATCSRLAKEAVSKGAKLLCFPENFSYVGAKDGDSVK
VAEPLDGPILQQYCSLARESGIWLSLGGFQERVDDTHLHNTHVVIDDAGNIRSTYKKIHL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgccaattcagtccgagttgccgccgctcagatgacttcgatcaacgacctc
gctgccaattttgccacctgctcccgcctcgccaaggaagcggtttcaaagggggcaaag
ttgctttgcttccctgagaacttctcttatgtgggtgctaaggatggagacagtgttaaa
gttgcagaacccttggacggtcccattttgcagcaatactgctctctagcaagagagtcc
ggaatttggctgtcactgggaggcttccaggagagagtagatgacactcatttgcataat
acacatgtcgtgattgatgatgcagggaacattcgcagcacttataagaagatacacttg
taa

DBGET integrated database retrieval system