KEGG   Carica papaya (papaya): 110824298Help
Entry
110824298         CDS       T05151                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00450  Selenocompound metabolism
cpap00970  Aminoacyl-tRNA biosynthesis
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110824298
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110824298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpap01007]
    110824298
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpap03016]
    110824298
Enzymes [BR:cpap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110824298
Amino acid related enzymes [BR:cpap01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110824298
Transfer RNA biogenesis [BR:cpap03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110824298
 Prokaryotic type
   Other AARSs
    110824298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g
Motif
Other DBs
NCBI-GeneID: 110824298
NCBI-ProteinID: XP_021910575
Position
Unknown
AA seq 182 aa AA seqDB search
MASFTALDWQGWHEDGEITWKVEFGNDGDYSEDHFINIINAHLANTIGNILNRTLRLLKK
NCQSTLVVDSASAAEGNPFRDTVEKLDLVIILEAVRIIAIALSPVTPGLSWRIYSQLGYT
KDQFNTAAWSETRCVGLKGGQVMAPPKPVFARIEQGAETEAGGVVAKKVVKNKERIPQAQ
EA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcactgcccttgattggcaaggatggcatgaagatggggaaataacttgg
aaggtggaatttggaaatgatggggattattcggaagatcattttattaatatcatcaat
gcacatcttgctaatacaataggaaatattcttaatcgtactcttaggcttcttaagaag
aactgccaatcaaccttggtggttgattcagctagtgcagctgaaggaaatcctttcaga
gacactgtggagaagctggatcttgttattatactggaagctgtgaggattattgcaata
gctttgtctccagtcacccctggcttatcatggcgaatatattcacagctaggctacacg
aaggaccagtttaacactgcagcctggagcgagacaaggtgcgttgggctaaagggtggt
caggtcatggctccacccaaaccagtgtttgcaaggattgaacaaggagcagaaacagaa
gctggtggagtagtagccaagaaggttgttaaaaacaaggagagaatacctcaggctcaa
gaggcttaa

DBGET integrated database retrieval system