KEGG   Carica papaya (papaya): 110825652Help
Entry
110825652         CDS       T05151                                 

Definition
(RefSeq) probable serine/threonine-protein kinase At1g54610
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpap01001]
    110825652
Enzymes [BR:cpap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110825652
    2.7.11.23  [RNA-polymerase]-subunit kinase
     110825652
Protein kinases [BR:cpap01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110825652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 110825652
NCBI-ProteinID: XP_021911819
Position
Unknown
AA seq 431 aa AA seqDB search
MGCVLGREVSSGVVSESKEAKHLRVESNRKVDNVSVAKVDTSNVEIQNEETHKEEKADGD
RKTRGERRRSRPNPRLGSLPKHSRGEQVAAGWPSWLSDVCGEALNGWLPRRADTFEKIDK
IGQGTYSNVYKAKDMLTGKIVALKKVRFDNLEPESVKFMAREILILRTLDHPNVVKLEGL
VTSRMSCSLYLVFQYMEHDLAGLAASPAVKFTEPQVKCYMHQLLSGLEHCHKRGVLHRDI
KGSNLLIDDGGVLKIADFGLATFFDPNNKHHMTSRVVTLWYRAPELLLGATDYGVGIDLW
SAGCILAELLAGRPIMPGRTEVEQLHKIYKLCGSPSDEYWKKSRLPNATLFKPREPYRRC
IKETFKDFPPSSLPLIETLLAIDPAERQTATAALRSEFFMTEPYACEPSSLPKYPPSKEM
DAKRRDDEARR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtgtattgggacgagaggtatcctcaggcgtagtgtctgagtccaaagaggca
aaacacttgagggttgaatctaacaggaaagtagacaatgtttcagtggcaaaggttgat
actagtaatgtagagattcaaaatgaggagacccataaggaggagaaggctgatggggac
agaaaaacaaggggggaaagaagaaggtcgaggccaaatccaaggttgggcagtctgcca
aagcattcgcgtggagagcaggtagcagccgggtggccgtcttggttgtcagatgtgtgt
ggggaagctctcaatggctggcttccacggagggcggacacctttgagaagattgataag
attgggcaaggaacgtatagcaatgtgtataaagccaaagatatgttaacaggtaaaatt
gttgcattgaagaaggttcgatttgacaatttggaaccggagagtgtgaaatttatggct
agagagattctcatattgaggacattggaccatcccaatgttgtgaagttggaaggtttg
gttacttcaaggatgtcctgtagtttgtatctcgtatttcagtacatggagcatgatttg
gccggacttgctgcaagtccggcagtcaagttcacagagccacaggttaaatgttacatg
catcaacttttgtctgggcttgagcactgtcacaaacgtggtgttcttcaccgtgacatt
aaagggtcaaaccttcttattgatgatgggggagtacttaagattgctgattttgggctg
gcaacattctttgatccaaacaacaagcatcacatgacaagtcgggtggttactctatgg
tatcgagccccagagctacttctcggggctactgattatggtgtaggcattgatctttgg
agtgcaggctgtattttagctgagctcttggctggaaggccaatcatgcctggtcgtaca
gaggtagagcaactacataagatatacaagctatgtggttcaccttcagatgaatactgg
aaaaagtcaagattaccaaatgcaactttgttcaagccccgtgagccgtacagaagatgt
ataaaagagacatttaaggattttccaccttcatcactgcccctcatcgaaactcttctt
gcaattgatccagcagaacgccagactgcaacagctgcattaagaagtgaattctttatg
acagaaccttatgcttgtgaaccttctagtcttccaaaatatcccccgagtaaagaaatg
gatgctaaacgaagagatgatgaagctcgacggtga

DBGET integrated database retrieval system