KEGG   Citrobacter pasteurii: CUC49_02975Help
Entry
CUC49_02975       CDS       T05874                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00860  Porphyrin and chlorophyll metabolism
cpar01100  Metabolic pathways
Module
cpar_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CUC49_02975
Enzymes [BR:cpar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CUC49_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AYL60685
Position
complement(639498..640109)
Genome map
AA seq 203 aa AA seqDB search
MRLWLVRHGETEANIAGLYSGHAPTPLTERGIVQAQSLSGLLRNVPFDNVLCSELERARH
TTQLILAERDVPVCVMPELNEMFFGDWEMRHHRDLAREDAENYAVWCNDWQNATPTNGEG
FQAFSQRVERFIAQLAEYKDSKNLLVVSHQGVLSVLVARLLSMPTAAMWHFRIEQGCWSA
IDFCDDFAVLKVLNSRAVWHEGE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagactctggttagtacgtcacggagaaaccgaagccaatatcgctgggctatacagc
ggtcatgcccccacaccgctaacggaacgggggattgttcaggcgcaatcactgagtggg
ctgctacgcaatgtccctttcgacaacgttctgtgcagcgagctggaacgcgcccgccat
acaacccaactgattctggcggaacgcgatgttcctgtgtgtgtcatgcctgaacttaat
gagatgttctttggcgactgggaaatgcgccatcatcgcgatcttgcgcgcgaagacgct
gaaaattatgccgtatggtgtaacgactggcagaacgcaaccccaactaatggcgaagga
tttcaggcattttcacagcgtgttgaacgtttcattgctcagcttgctgaatacaaagac
agtaaaaatctgttggtggtaagtcatcagggcgtgctgagcgtactggtggcccggctg
ctgtccatgcccacggccgccatgtggcactttcgcatcgaacagggatgctggagtgcc
attgatttttgtgacgactttgcagttctgaaagttctcaatagtcgcgccgtgtggcac
gagggtgagtga

DBGET integrated database retrieval system