KEGG   Citrobacter pasteurii: CUC49_03400Help
Entry
CUC49_03400       CDS       T05874                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00630  Glyoxylate and dicarboxylate metabolism
cpar00660  C5-Branched dibasic acid metabolism
cpar01100  Metabolic pathways
cpar01120  Microbial metabolism in diverse environments
cpar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CUC49_03400
   00660 C5-Branched dibasic acid metabolism
    CUC49_03400
Enzymes [BR:cpar01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     CUC49_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AYL60759
Position
complement(723435..724676)
Genome map
AA seq 413 aa AA seqDB search
MKIKKALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFLAENFIPFLNDHIKPLLEGRDVDAFLPNARFFDQLR
IDGHLLHTAVRYGLSQALLDAAALATGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIA
VDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRTSERYHPTLHIDVY
GTIGLIFDMDPVRCAEYIASLEAEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGS
GVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHAMEAYQGGT
CNETEISARTCVHVALAARPMRMLVKPGMGFDEGLNIVFNEMNRTIALLQTKD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaggcccttttcaccgctggctactcctcattttattttgacgatcag
caggccatcaaaaatggcgccggtcatgacgggtttatctataccggcgatccggtaaca
cctggatttacctctgttcgtcaggcgggtgaatgcgtttccgtgcaactgattctggaa
aatggcgcggtagcggtgggcgattgcgcagcggtgcaatattcaggtgcaggtggccgt
gatccgctattcctggcagaaaatttcattccgttcctcaacgatcacatcaaaccgctg
ctggaaggccgtgacgttgatgcgttcctgccgaacgcccgtttctttgatcaactgcga
attgacggccatctgctgcataccgccgtccgctatggtctgtctcaggcgctgctcgac
gcggcagcgctggctaccggtcgtctgaaaactgaagtggtttgcgatgaatggcaactg
ccgtgcgtgccggaagccattccattatttggtcagagcggcgacgaccgttatatcgcc
gttgacaaaatgatcctcaaaggggtggacgtcctgccgcatgcgctgatcaacaacgtg
gaagagaaactgggctttaaaggcgaaaaactgcgtgagtatgtacgttggttgtccgac
cgcattttaagcctgcgcaccagcgaacgttatcacccaacgctgcatattgatgtgtac
ggcacgatcggtctgatcttcgatatggatcccgtgcgctgcgccgaatacatcgccagc
ctggaagccgaagctcaaggcctgccgctgtacattgaaggtccggtagatgccggtaac
aagccggatcagatccgcatgttgactgccatcaccaaagagctgacccgtctgggttcc
ggcgtgaaaattgtcgccgacgaatggtgtaacacctatcaggatatcgtggactttacc
gatgcgggcagctgccacatggtacagatcaaaacccctgatcttggcggtattcacaac
atcgttgatgcggtgctgtattgcaacaaacacgccatggaagcttatcagggcggtact
tgtaacgaaaccgagatcagtgcccgcacctgcgtacacgtggcgcttgccgcgcgtccg
atgcgtatgctggttaaaccgggtatgggtttcgatgaaggtctcaacatcgtgtttaac
gagatgaatcgcaccatcgcgttgttgcaaactaaggattaa

DBGET integrated database retrieval system