KEGG   Citrobacter pasteurii: CUC49_07115Help
Entry
CUC49_07115       CDS       T05874                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00480  Glutathione metabolism
cpar00590  Arachidonic acid metabolism
cpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CUC49_07115
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUC49_07115
Enzymes [BR:cpar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CUC49_07115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AYL61421
Position
complement(1476802..1477284)
Genome map
AA seq 160 aa AA seqDB search
MTTFYQLTATSLDGQRIPMADYAGKLVLVVNTASHCGFTPQYAGLETLYKKYAARGLVVL
GFPCNQFGKQEPGEADEIAQTCHINYGVSFPMFEKVEVNGAATHPVFRYLKDELPGMLGG
RIKWNFTKFLIGRDGKPLKRFAPFTTPEKMETIILAALEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttttatcaactaacagccaccagcctggacggccagcgtatccctatggct
gactatgctggcaagctggttctggtggtaaataccgccagccattgtggcttcacgcca
caatatgcaggtctggaaacgctttacaaaaagtatgcagctcgcggactggtagtgctt
ggttttccctgcaaccagttcggtaagcaggaacccggcgaagccgacgaaatcgcgcag
acctgccacatcaactacggtgtaagcttcccgatgtttgaaaaagtggaggttaacggt
gccgctacgcatccggtattccgttatctaaaagacgagttgcccggcatgctgggggga
cggataaaatggaatttcacaaaattcctgatcgggcgcgatggcaagccgctaaagcgt
tttgcgccgttcactaccccggagaaaatggaaaccatcatacttgctgcacttgaaatc
tag

DBGET integrated database retrieval system