KEGG   Citrobacter pasteurii: CUC49_07905Help
Entry
CUC49_07905       CDS       T05874                                 

Definition
(GenBank) CoA transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00072  Synthesis and degradation of ketone bodies
cpar00280  Valine, leucine and isoleucine degradation
cpar00650  Butanoate metabolism
cpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CUC49_07905
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CUC49_07905
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CUC49_07905
Enzymes [BR:cpar01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CUC49_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AYL61568
Position
1629678..1630385
Genome map
AA seq 235 aa AA seqDB search
MAGLDKRVATYQEALAGLTDNMTLLAGGFGLCGIPENLIAEVRRREVQGLTVVSNNCGVD
GFGLGVLLETRQVRKVVASYVGENALFEKQVLSGELEAILTPQGTLAEQLRAGGAGIPAF
FTATGYGTPVAEGKEVREFDGRPYIMEQAITGDFALVKGWKADWYGNVIYRHTAQNFNPL
MAAAGRITVVEVEEIVPPGELDPAAIHTPGIFVNRIIQGQFEKRIEQRTLRQKGA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctggactggataaacgtgtcgccacgtatcaagaggcgctggcagggctgaccgac
aatatgacgctgctggcgggcggttttggcttatgcggcattcctgaaaacctgattgcc
gaagtacgccgtcgggaggttcagggactgaccgtcgtttcaaacaactgcggcgtggat
ggttttggcctgggtgtgctgctggaaacacgtcaggtacgtaaagtggtagcgtcctat
gttggcgaaaatgcgctgtttgaaaagcaggtactgagcggtgaactggaagccattctg
accccacagggcacgctggctgagcagttacgtgccggtggcgcagggatcccggcgttt
ttcaccgccacaggatacggtacacccgtcgccgaaggcaaagaggtacgtgaatttgac
ggccgtccttacattatggaacaggcgattaccggtgattttgcgctggtcaaaggctgg
aaagccgactggtacggcaacgttatttatcgccacaccgcacagaattttaatccactg
atggccgccgccgggcgtattaccgtcgtggaagtcgaagaaattgtccctcccggcgag
ctggatcccgccgcaattcataccccgggaattttcgtaaaccgcatcattcaggggcag
tttgaaaaacgcattgaacaacgcaccctgcgccagaaaggagcctga

DBGET integrated database retrieval system