KEGG   Citrobacter pasteurii: CUC49_08895Help
Entry
CUC49_08895       CDS       T05874                                 

Definition
(GenBank) 5'-3' exoribonuclease
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cpar  Citrobacter pasteurii
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CUC49_08895
Enzymes [BR:cpar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CUC49_08895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AYL61751
Position
complement(1831366..1832244)
Genome map
AA seq 292 aa AA seqDB search
MSDTNYAVIYDLHSHTTASDGRLTPEALVHRAVEMRVGTLAITDHDTTAGIAAAREEISR
SGLALNLISGVEISTVWENHEIHIVGLNIDIAHPVMCDFLAQQTERRQQRARLIAERLDK
AHIPGAWEGALRLADGGAVTRGHFARFLVECGKATTMADVFKKYLARGKTGYVPPQWCTI
EQAIDVIHHSGGKAVLAHPGRYDLSAKWLKRLVAHFAEHRGDAMEVAQCQQSPNERTHLA
TLARQHQLWASQGSDFHLPCPWIELGRKLWLPAGVEGVWQLWEQPETTERKV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacacgaattacgcagtgatttatgacctgcacagccatactactgcttctgat
gggcgattaacgccagaagccttagtacaccgtgcggtagagatgcgagtcggtacactg
gcgatcacagatcatgacaccacggcgggcattgcggcggcaagagaagaaatttcacgt
tcaggtttagcgttaaatttgatctctggcgttgagatatcaacggtctgggaaaaccat
gagatccatatagtgggtctgaacattgatatcgcgcatccagtgatgtgcgactttctg
gcgcaacagacggaacgtcgccagcagcgcgcgcgcctgattgctgaacggctcgacaaa
gcgcacattcccggcgcatgggaaggggctctacgactggctgatggcggggcggttacg
cgggggcattttgcgcgtttcctggtggaatgtggcaaagccacaaccatggcggatgtc
tttaaaaaatatcttgctcgtgggaaaaccggttacgttccgccacagtggtgtacaata
gaacaagctattgatgtcattcatcattctggcggtaaggcagttctggctcatcctggt
cggtacgatcttagcgctaagtggctgaaaagactggttgcgcattttgctgagcaccgc
ggtgacgcgatggaggtggcacagtgccagcagtctcccaatgaacgcacccatctggcg
acgcttgcgcgtcagcatcaactgtgggcatcgcaagggtctgattttcatctaccctgc
ccatggattgaactggggcgtaaactctggttgcccgcaggcgtagaaggcgtctggcaa
ctttgggagcagcccgagaccacagagaggaaagtatga

DBGET integrated database retrieval system