KEGG   Citrobacter pasteurii: CUC49_16705Help
Entry
CUC49_16705       CDS       T05874                                 

Definition
(GenBank) aerobic respiration two-component sensor histidine kinase ArcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CUC49_16705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpar01001]
    CUC49_16705
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cpar02022]
    CUC49_16705
Enzymes [BR:cpar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CUC49_16705
Protein kinases [BR:cpar01001]
 Histidine kinases
  OmpR family
   CUC49_16705
Two-component system [BR:cpar02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   CUC49_16705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HKR_ArcB_TM HATPase_c Response_reg PAS HisKA PAS_4 Hpt PAS_9 HATPase_c_3 CCB1 PAS_8
Motif
Other DBs
NCBI-ProteinID: AYL63151
Position
complement(3394760..3397096)
Genome map
AA seq 778 aa AA seqDB search
MKQIRMLAQYYVDLMMKLGLVRFSLLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIF
FGLLITPWAVYFLSVVVEQLEESRQRLSRLVQKLEEMRERDLKLNVQLKDNIAQLNQEIV
EREKAEAERQETFEQLKVEIKEREEAQIQLEQQSSFLRSFLDASPDLVFYRNEDKEFSGC
NRAMELLTGKSEKQLVNLKPADVYSPEAAEKVIETDEKVFRHNVSLTYEQWLDYPDGRKA
CFEIRKVPYYDRVGKRHGLMGFGRDITERKRYQDALERASRDKTTFISTISHELRTPLNG
IVGLSRILLDTDLTAEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVDFTS
FMADLENLSGLQAQQKGLRFVLEPTLPLPHKVITDGTRLRQILWNLISNAVKFTQQGQVT
VRARYDEGDILHFEVEDSGIGIPQDEQDKIFAMYYQVKDSHGGKPATGTGIGLAVSKRLA
KNMGGDITVSSQAGKGSIFTLTVHAPAVAEEIEDAFEDDEMPLPALNVLLVEDIELNVIV
ARSVLEKLGNSVDVAMTGKAALDMFKPGEYDLVLLDIQLPDMTGLDISRELTQKYAREDL
PPLVALTANVLKDKKEYLDAGMDDVLSKPLSVPALTAMIKKYWDTRNEEESTVTSEESSK
SQALLDIPMLEQYLELVGPKLITDGLAVFEKMMPGYLSVLESNLTARDKKGVVEEGHKIK
GAAGSVGLRHLQQLGQQIQSPDLPAWEDNVAEWIEEMKQEWQHDVAVLRAWVASVEKK
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaattcgtatgctggcgcaatactatgtcgacctgatgatgaagttaggtctg
gtgcgcttttcgctgctgttggctctggctttggttgtgttggcaattgtggtgcagatg
gctgtcaccatggtgctgcatggccaggtagaaagcattgatgtcatccgttctatcttt
tttggcctgttaattaccccctgggccgtctacttcctttctgtggtggtggagcaactg
gaagagtcccggcaacgcttgtcacgactggtacaaaagctggaagagatgcgcgagcgc
gatctcaagctcaatgtgcagttgaaagataatattgcccagctcaaccaggaaattgtc
gagcgcgaaaaagccgaagcggagcgccaggaaacgttcgaacaactgaaggttgaaatc
aaagagcgcgaagaagcgcagatccagctcgagcaacaatcttcatttttacgttctttc
cttgatgcttcaccggacctggttttttatcgcaatgaagataaagaattctccggctgt
aaccgtgctatggagctgctgaccggtaagagcgaaaagcaactggtgaatctaaagccg
gctgatgtgtattcgccagaggcggctgaaaaggtgattgaaaccgacgagaaggtattc
cgtcataacgtctcgctcacctatgaacagtggctggactacccggatgggcgcaaagcc
tgctttgaaattcgtaaagtgccttactatgaccgcgtcgggaagcgacatggcctgatg
ggctttgggcgcgatattaccgagcggaagcgttatcaggacgcgcttgagcgcgccagc
cgtgataagaccactttcatttccaccatcagccacgagctgcgcactccgcttaacggc
attgtcggcttaagccggatcctgttggatacagatttaaccgctgagcaggaaaaatat
ctcaaaactatccatgtttccgccgtgacgctggggaatattttcaacgatattattgac
atggataagatggagcggcgtaaagtccagcttgataaccagcctgttgatttcaccagc
tttatggctgatctggaaaacctctccggcctgcaggcgcaacaaaaagggctgcgcttt
gtgcttgagccgacgctaccgctgccacataaggtcatcaccgacggaacgcgtttgcgc
cagattctgtggaatctgatcagcaacgccgtgaagtttactcagcaggggcaggtgacc
gtacgggcgcgctatgacgagggagacatactgcattttgaggtggaggattccgggatc
ggtattccacaggatgagcaggataaaattttcgccatgtactatcaggtgaaggacagc
catggtggtaaaccggcaacgggaaccgggattggactggccgtctcgaagcgtctggcg
aaaaacatgggcggtgatattacggtttccagccaggccggaaaaggctccatctttacg
ctaaccgtgcatgctcctgccgtggcagaagaaattgaagatgcttttgaagacgatgaa
atgccgttaccagccctgaatgtgctgctggtggaagacattgaactgaacgttattgtt
gcgcgttcggtgctggaaaagctgggcaacagcgtggatgtcgccatgaccgggaaagcc
gcgctggacatgttcaaaccgggtgaatatgacctggtgctgctggatattcagctaccg
gatatgacagggctcgatatctcacgagaactgacgcaaaaatacgcccgtgaagatctg
ccgccgctggtggctctcaccgccaacgtactgaaagataaaaaagaatatctggatgca
ggaatggacgacgtgctgagtaagccgctgtcagttccggcgttaaccgccatgatcaaa
aaatactgggatacccgaaacgaagaggagagcactgtgacgtctgaagaaagcagtaaa
tcgcaagcgctgttagatattcccatgttggaacaatacctcgaactggtcgggccgaag
ctgatcaccgacggtctggcggtgtttgagaaaatgatgccaggatatttgagcgtgctg
gagtctaatctgactgcccgtgataaaaaaggcgtggttgaggaaggtcataaaattaaa
ggtgcagccggatctgtcggtctgcgccacctgcaacagttgggtcagcaaattcaatca
cccgaccttcccgcctgggaagataacgtggctgaatggattgaagagatgaagcaggag
tggcagcacgacgtggcggtgttaagagcctgggttgcgagcgtggaaaaaaaatga

DBGET integrated database retrieval system