KEGG   Citrobacter pasteurii: CUC49_17240Help
Entry
CUC49_17240       CDS       T05874                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cpar  Citrobacter pasteurii
Pathway
cpar03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CUC49_17240 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpar03011]
    CUC49_17240 (rplV)
Ribosome [BR:cpar03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CUC49_17240 (rplV)
  Bacteria
    CUC49_17240 (rplV)
  Archaea
    CUC49_17240 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AYL63246
UniProt: A0A0A1RAX3
Position
complement(3492945..3493277)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gcagacctgattcgcggtaagaaagtgtcgcaggcccttgatattctgacctacaccaat
aagaaagcggctgtactggttaagaaagtcctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttacgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system