KEGG   Citrobacter pasteurii: CUC49_18665Help
Entry
CUC49_18665       CDS       T05874                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00540  Lipopolysaccharide biosynthesis
cpar01100  Metabolic pathways
Module
cpar_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CUC49_18665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cpar01005]
    CUC49_18665
Enzymes [BR:cpar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CUC49_18665
Lipopolysaccharide biosynthesis proteins [BR:cpar01005]
 Unusual sugar
  CUC49_18665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: AYL63508
UniProt: A0A0A1RSD8
Position
3785595..3786527
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKSLNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MAGEDFGDIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGETPKLFEGSENFKRDFVYVGDVAAVNLWFLENGVSGIFNLGTGRA
ESFQAVADATLAYHKKGSIEYIPFPEKLKGRYQAFTQADLTNLRAAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaacatcgttaagtccctgaat
gacaaaggcatcaccgatattctggtggtggacaacctgaaagacggcaccaagtttgtg
aatctggtggatctgaatattgctgactatatggataaggaagacttcctgatccagatt
atggccggggaagattttggcgatatcgaagcgattttccacgaaggcgcatgctcttcc
accaccgagtgggatggcaagtatatgatggacaacaactatcaatactccaaagagctg
ctgcactactgtctggagcgtgaaattcctttcctgtatgcctcttctgcagcaacgtac
ggcggtcgtacctctgacttcatcgaatctcgtgaatatgagaagccgctgaacgtctat
ggctactcaaaattcctgttcgacgaatatgtacgccagatcctgccagaagcaaattct
cagatcgttggcttccgttatttcaacgtctacggaccgcgcgaaggtcacaaaggcagc
atggcgagcgtcgctttccatctcaatactcagctcaataacggcgaaacacccaagctg
ttcgaaggaagtgaaaacttcaaacgtgatttcgtctatgtcggcgatgttgcagcagta
aacctgtggttcctggaaaacggggtttccggcatctttaacctcggtactggtcgcgca
gagtctttccaggccgtcgcggatgccacgctggcataccacaaaaaaggcagcattgag
tacattccgttcccggaaaaactgaagggccgctatcaggcatttactcaggcggatctg
actaacctgcgcgctgcgggctatgacaagccgtttaagaccgttgctgaaggcgtaacg
gaatatatggcctggctgaaccgcgacgcttaa

DBGET integrated database retrieval system