KEGG   Citrobacter pasteurii: CUC49_19905Help
Entry
CUC49_19905       CDS       T05874                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cpar  Citrobacter pasteurii
Pathway
cpar00860  Porphyrin and chlorophyll metabolism
cpar01100  Metabolic pathways
cpar01110  Biosynthesis of secondary metabolites
Module
cpar_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cpar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CUC49_19905 (hemN)
Enzymes [BR:cpar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CUC49_19905 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF3926
Motif
Other DBs
NCBI-ProteinID: AYL63728
Position
4037530..4038903
Genome map
AA seq 457 aa AA seqDB search
MSEQLIDWDLALIQKYNYSGPRYTSYPTALEFSEDYGTEAFLKAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIIHRAPLFVGRHVSQLHWGGGTPTYLNK
AQISRLMSLLRGNFNFNDDAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLPTLFAAQRKIKDADLPSAQQKLDILQETISSLTETGYQFIGMDHFARPDDELAIA
QRKGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDNYAQNQKELKRYYQQVDEQGNALWRG
IALTRDDCIRRDVIKLLICNFRLDYAAVEQQWDLNFADYFAEDLKLLAPLAKDGLVDVDE
KGVQVTPKGRLLIRNICMCFDAYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcagctaatagactgggacctggccctgatccagaaatataactattccggg
ccacgatatacctcgtacccgaccgcgctggagttttctgaagactacggcacagaagca
tttctaaaggccgtggcgcgttatcctgagcgtccgctctcgctatacgttcacatcccg
ttctgccacaaactgtgctacttctgtggctgcaacaagattgtgactcgccagcagcat
aaagccgatcaatacctcgatgccctggaacaagaaattattcaccgcgctccgctgttc
gtcggacgccatgtcagccaactgcattggggcggcggtacgccaacttacttaaataaa
gcgcaaatcagccgtttgatgtcgctgctgcgtggtaatttcaactttaacgatgacgcc
gaaatctcgatcgaagttgatccgcgcgaaattgagctggatgtccttgatcatttacgt
gctgaaggttttaaccgcctgagcatgggggtacaggacttcaacaaagaagttcagcgc
ctggtgaaccgtgagcaggatgaggagtttatctttgcgctgctgaatcatgcgcgtgag
attggctttacctcaacgaatatcgatctgatttatggtttgccaaaacagacgccggaa
agtttcgcctttaccctgaaacgcgttgctgagctgaatccagaccgactgagcgtcttc
aactacgcgcacctgccgacgctgtttgccgctcagcgcaagattaaagacgctgacctg
cccagcgcgcagcagaagctggatatcctgcaggaaaccatttcttcactgaccgaaacc
ggttatcagttcattggtatggatcactttgctcggccggatgatgagctggcgattgct
caacgcaagggtgtgctgcatcgtaatttccagggttataccacccagggtgataccgat
ctgctgggaatgggcgtgtcagccattagtatgattggtgacaactacgcgcagaaccag
aaagagctgaagcgctattatcagcaggttgacgagcaggggaacgcactgtggcgcgga
attgccctgacccgcgatgactgcatccgtcgtgatgttattaagctcctgatctgtaac
ttccgcctcgactatgccgctgtggaacagcaatgggatctgaacttcgctgactatttt
gccgaagacctgaaactgctggcaccactggcgaaagatgggctggtggatgtggatgag
aagggggttcaggttacgccgaaggggcgcctgctgatccgcaatatttgtatgtgcttt
gatgcctatctgcggcagaaagcacgcatgcagcagttctcacgggtgatttaa

DBGET integrated database retrieval system