KEGG   Clostridium pasteurianum BC1: Clopa_0818Help
Entry
Clopa_0818        CDS       T02645                                 

Definition
(GenBank) 2-keto-3-deoxygluconate permease
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdgT
Motif
Other DBs
NCBI-ProteinID: AGK95843
UniProt: R4JZU3
Position
820827..821834
Genome map
AA seq 335 aa AA seqDB search
MKIMKTIQKVPGGMMVIPLLLAALINTFAPNALKIGSFTTAVFSNTAAATVVGLQLFFIG
TGLRIKEAPEAIKRGSVLLISKYIAGAVLGIVIAKLFGTAGILGVSVLAIISSVTGANGS
LYLALMGEYGDSKDLAAQSIMNIHDGPFLALLTFGVSGLANIPLMALFAAIVPLIIGCIL
GNLDVDFRKFFSQGVSITIPFIGFALGAGINFFSIVRAGFSGVILAAMVFIIGGGCAILG
DKFINRRPGYAGAAIASAAGNTIATPAAIALVDKTYAPFVASATAQIAAAVVITAIIVPP
FVDRMAKKYGSPKLQNSKAEGNVSSSVDSNIETIP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatgaaaaccattcaaaaagttccagggggaatgatggttatacccttatta
ttagcggcattaatcaataccttcgcacctaatgctttaaaaataggatcttttaccaca
gcagttttttctaacacagcagcagctacagtagtgggattgcagttattctttatagga
acaggattaaggataaaggaagctccagaagcaattaaaagaggatctgttttacttata
tcgaagtatattgcaggggcagttttaggaattgttatagctaagttatttggaacagca
ggtatcttgggagtgtcagttctagctattataagttccgttacaggtgccaatggaagc
ttatatcttgctctaatgggagagtatggagattcaaaagaccttgcagctcaaagtatt
atgaatatccatgatggaccctttttagctcttctcacctttggtgtatcaggtttagcc
aatatacctttaatggctctatttgctgccattgttccattaattataggatgcatacta
ggaaatttagatgtggatttcagaaaattcttttcacagggtgtaagtataacaataccc
ttcattggctttgcactgggagcaggaataaacttcttcagtattgtaagggctggcttt
agtggagtgattttagcagcaatggtatttatcattggtggaggctgtgcaattctcgga
gataaatttatcaatagaagaccaggttatgcaggagctgctatagcaagtgcagcagga
aatacaatcgcaacaccggcagctattgctttagttgataaaacctatgcgccttttgtt
gcatcagctactgcacaaatagcagcagcggtagttataacagctattatagttccacct
tttgttgatagaatggcaaaaaaatatggatcacctaagctccaaaacagtaaagcagag
ggtaatgtaagcagcagcgtagacagcaacatagaaactattccatag

DBGET integrated database retrieval system