KEGG   Clostridium pasteurianum BC1: Clopa_1159Help
Entry
Clopa_1159        CDS       T02645                                 

Definition
(GenBank) isopropylmalate/homocitrate/citramalate synthase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00360  Phenylalanine metabolism
cpas00362  Benzoate degradation
cpas00621  Dioxin degradation
cpas00622  Xylene degradation
cpas01100  Metabolic pathways
cpas01120  Microbial metabolism in diverse environments
cpas01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Clopa_1159
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Clopa_1159
   00622 Xylene degradation
    Clopa_1159
   00621 Dioxin degradation
    Clopa_1159
Enzymes [BR:cpas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Clopa_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AGK96154
UniProt: R4K6M0
Position
1190826..1191872
Genome map
AA seq 348 aa AA seqDB search
MKNVNILDCTLRDGGYINNWSFSDDTASNLIDSLIESKVEFIELGYISKKSDRCGDSTMF
NSIECIENILTNNNAKYLVMMNLGDFDVDNMDYNDNIFGIRLAFRKEEWREAFQQAEKII
EKGFKVFIQPMVTLSYTEEELLEVINEFNKLDIYAFYIVDSFGSMHDKDILRLASLVDNN
LKASVRLGLHAHNNLQLAFSNAITLLQSVSDRQLIIDSSVLGMGRGAGNLNTELFVDYLV
RNFDKDYKIQPLLDIIDNSLNKIHRENYWGYSPAHYISAIYNCHPNYSTYLAGKSNLTAK
DTENIIKNIVDEKKNKFDKTYIEDLYTQYISKKCMDYDCELLTRAAQI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtaaatatattggattgtacactgagggatggaggatatataaataattgg
tccttctccgatgatactgcttcaaaccttattgattctttaatagaatctaaagttgaa
ttcatagagcttggatatataagcaaaaaaagtgatagatgtggagatagtactatgttt
aatagcatagaatgtattgaaaacatactaactaataataatgctaaatatcttgttatg
atgaatttaggagattttgatgtagataatatggactataacgataatatctttggtata
aggcttgcttttcgtaaggaagagtggagagaagcttttcagcaggccgaaaaaataata
gaaaagggctttaaagtttttattcagcctatggtgactttatcttatactgaagaggaa
ctgttagaagttataaatgaattcaataaattagatatatatgctttctatatagtagat
agttttggatccatgcatgataaggatattttaagattagcttccttagttgataataat
ttaaaagctagtgttagattaggcttacatgcacacaataatcttcaacttgccttttca
aatgccataactttactgcagtcagttagtgacagacaattaataattgattcatcagtt
ttaggaatgggaaggggagcaggaaacttaaatacagagttatttgtagattatttagta
agaaattttgataaagattataaaatacaacctttattagatataatagataattcttta
aataagattcatagagaaaattactggggatattcacctgctcactatatatctgcaatt
tataattgtcatccaaattattcaacttacttagctggcaaatcaaatcttacggcaaag
gatacagaaaatataattaaaaatatagttgatgaaaagaaaaataaatttgataaaact
tatatagaagatttatatacccagtatatttcaaaaaagtgtatggattatgattgtgaa
ttgttaactagagcggctcagatataa

DBGET integrated database retrieval system