KEGG   Clostridium pasteurianum BC1: Clopa_1339Help
Entry
Clopa_1339        CDS       T02645                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IIA component
  KO
K02812  sorbose PTS system EIIA component [EC:2.7.1.206]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00051  Fructose and mannose metabolism
cpas01100  Metabolic pathways
cpas02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clopa_1339
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Clopa_1339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpas02000]
    Clopa_1339
Enzymes [BR:cpas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     Clopa_1339
Transporters [BR:cpas02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    Clopa_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: AGK96324
UniProt: R4K720
Position
1395926..1396351
Genome map
AA seq 141 aa AA seqDB search
MIPIIIAAHGKLAGELLNSAEMIFGKQENIETILFVPGENTEDLKIKYREKLEHFKDSKE
VLIIVDLFGGSPYNAAFEIAIINENIDILTGASLPMLLEVLSVRDGENIKIQDIIKTIND
SANSYIRSCKQLQASIEEEEL
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgatacctattattatagctgctcatggtaaattggcaggtgaactactaaattcggct
gaaatgatttttggtaagcaggaaaatatagaaacaatattatttgtaccaggagaaaat
acagaagatttaaaaattaaatatagagagaaactggaacattttaaagattcaaaagaa
gtattaattatagtggatttatttggtggaagtccatacaatgcagcctttgaaattgca
attataaatgaaaatattgacattttaacgggagcaagtttaccaatgttattagaagtt
ttatctgttagagatggtgaaaatattaaaattcaagacattataaaaactataaatgac
agcgcaaattcttacattcgttcatgtaaacaattacaagcaagtatagaagaggaggaa
ttataa

DBGET integrated database retrieval system