KEGG   Clostridium pasteurianum BC1: Clopa_1399Help
Entry
Clopa_1399        CDS       T02645                                 

Definition
(GenBank) mannitol-1-phosphate/altronate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00051  Fructose and mannose metabolism
cpas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clopa_1399
Enzymes [BR:cpas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     Clopa_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA Ribul_P_3_epim UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGK96375
UniProt: R4K9Q6
Position
1454626..1455780
Genome map
AA seq 384 aa AA seqDB search
MKAVHFGAGNIGRGFIGYLLSKSEYDITFVDISDFLVDNINEYGKYKVITLSDSKSEEEI
DNVKAVSLNDTEKLEKIILEADLITTSIGANNLKSTGELLNKLLMKRFKICGDKLLDIIA
CENALFATNILKESILEEATQEFKDYLDKSVGFPNSTVDRIVPNVKIKKESPIDVAVEDF
YEWDIEKNNVKINNNIVGAAYVDNLEPYLERKLFLLNGAHAATAYIGYIKGYKFIHEAIK
DEFIRNIAIGFHKEAIQALSKKHNLDIKLLNEYSQKLIKRFENFYLQDELFRVGRDPMRK
LSSNDRLITPLKLCYKLDMKYDNILYGVAAGFLFNYSGDEKAEKIQNSILSEGIHTTICN
ITGLEENNVLVNMIEDKYKELSNL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcattttggagcaggtaatataggaagaggattcattggatatttatta
tcaaagtcagagtatgatatcacttttgttgatatatcagattttttagtagataatata
aatgaatatggtaaatataaagttataactttaagtgattcaaagagtgaagaagaaatt
gataatgtaaaggctgtaagtttaaatgacacagagaaattagaaaaaattattttagaa
gcagatttaattaccacttctattggcgcaaataacttaaagagtacaggtgaattatta
aataagcttttgatgaaaaggtttaaaatatgtggagataaattactggatataattgca
tgtgaaaatgctctatttgctacaaatattttaaaagaatcaatattagaggaggcaact
caagaatttaaggattacctagataaatctgtgggatttccaaatagcacagtagacaga
attgttccaaatgtaaagatcaagaaggaatctccaatagatgtggctgtagaagatttt
tatgaatgggatattgaaaaaaataatgtaaaaatcaataacaatattgtaggtgcagct
tacgtagataatttagagccatatcttgaaagaaaattatttttattgaatggagcacat
gctgccactgcatatataggatatatcaaaggttataagtttatacatgaagcaataaaa
gatgaatttataagaaatattgccataggctttcataaggaagctatacaagcgttaagc
aaaaaacataatctagatataaagcttttaaatgaatattctcaaaaattaataaaaaga
tttgaaaatttttatcttcaggatgagctatttcgtgtaggacgtgatcctatgagaaaa
ctatcttcaaatgatagattaataacaccacttaagctttgttataagctagatatgaaa
tatgataatattttatatggagtagcagcaggattcttatttaattatagtggagatgag
aaggctgaaaaaatacagaatagcatattgtcagaaggaattcatactacaatttgtaat
ataactggactggaggaaaataatgtcttagttaatatgattgaagataaatataaagaa
ttgtcaaatttatag

DBGET integrated database retrieval system