KEGG   Clostridium pasteurianum BC1: Clopa_1400Help
Entry
Clopa_1400        CDS       T02645                                 

Definition
(GenBank) alcohol dehydrogenase, class IV
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00010  Glycolysis / Gluconeogenesis
cpas00071  Fatty acid degradation
cpas00350  Tyrosine metabolism
cpas00620  Pyruvate metabolism
cpas00625  Chloroalkane and chloroalkene degradation
cpas00626  Naphthalene degradation
cpas00650  Butanoate metabolism
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01120  Microbial metabolism in diverse environments
cpas01130  Biosynthesis of antibiotics
cpas01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clopa_1400
   00620 Pyruvate metabolism
    Clopa_1400
   00650 Butanoate metabolism
    Clopa_1400
  Lipid metabolism
   00071 Fatty acid degradation
    Clopa_1400
  Amino acid metabolism
   00350 Tyrosine metabolism
    Clopa_1400
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clopa_1400
   00626 Naphthalene degradation
    Clopa_1400
Enzymes [BR:cpas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Clopa_1400
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clopa_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AGK96376
UniProt: R4K3T2
Position
1456170..1458776
Genome map
AA seq 868 aa AA seqDB search
MKVSSVDELNVRLEEMRKAQREFATYSQEQVDEIFRQAAMAALDARIPLAKMAAEETGMG
LVEDKVIKNHFAAEYIYNQYKDEKTCGVIETDESYGITKIAEPIGIVAAVIPTTNPTSTA
IFKTLISLKTRNAIMLSPHPRAKNSTIAAAKIILDAAVKAGAPEGIIGWIDEPSIELTQI
LMQEADITLATGGPSMVKSAYSSGKPAIGVGPGNTPVIIDESAHIKMAVSSVILSKTFDN
GVICASEQSVIVLDSIYDEVRKEFEERGAYIIKENEIDKVRDTIFINGGINSKIVGQSAY
KIAEMAGIKVPETARILIGEVTSVGKEEPFAHEKLSPVLAMYRAENFDDALEKAVTLVNL
GGLGHTSAIYADIIKAKDKIDKFSNAMKTVRTFVNIPTAQGASGDLYNFKIAPSFTLGCG
SWGGNSVSENVGPKHLLNIKRVAERRENMLWFRVPEKVYFKFGCLQFALRELKDLNKKRA
FIVTDKVLYDLGYIDSITKVLEEIGVDFKVFTEVEPDPTLATARKGAEEMMDFKPDTIIS
LGGGSAMDAAKIMWVLYEHPEVRFEDLAMRFMDIRKRIYNFPKMGEKAMMIAVATSAGTG
SEVTPFAVITDEKTGVKYPLADYELTPDMAIVDAELMMNMPKGLTAASGIDALIHGIEAY
TSVLASEYTNGLALEAIRLIFKYLPKAYSEGTTNEKAREKMAHASTMAGMAFANAFLGVC
HSMAHKLGAEHHIAHGTANALLIEEVIRFNSADNPVKQASYPQYKYPNAKWRYGKIADYL
GLGGSTDEEKVELLIKAIHELKEKINLPMTIKEAGVSDKKFYATLDKMCELAFDDQCIGA
NPRYPLISEIKQMFINAFDKAEIDTEIK
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttagtagtgttgatgaattgaatgtaaggttagaggaaatgagaaaagcccaa
agagaatttgcaacatactcgcaggagcaggtagatgaaatctttagacaggcagcaatg
gcagcattggatgcaagaataccacttgcaaaaatggcggcagaagaaactggaatggga
cttgttgaagataaagttataaaaaatcattttgcagctgagtatatatacaatcagtat
aaggatgaaaagacctgcggggtaatagaaacagacgaatcctatggaataactaaaatt
gcagaacccataggcattgtggcagccgtaataccaacaactaatccaacctcaacagca
atatttaagacattgatatcactaaaaactagaaatgctataatgttatcaccacatcca
agggcaaaaaattcaaccatagcagcagctaaaataatacttgatgcagcagttaaagca
ggtgctccagagggaataataggctggatagatgagccatcaattgaactaacacaaata
ctgatgcaggaggcagatataactcttgctacagggggaccatccatggttaaatcagcc
tattcctctggtaagccagctataggtgtgggaccaggaaacactcctgttataattgat
gaaagtgcacacataaaaatggcagtaagttcagtaattctttcaaagacttttgataac
ggtgtcatatgcgcttccgaacaatctgtaatagttttggattctatatacgatgaagta
agaaaagaatttgaagaaagaggagcatatataattaaggaaaatgaaatagacaaagta
agggatacgatttttataaatggaggcataaattccaaaatagtaggtcaatcagcctat
aaaatagctgaaatggcaggaattaaggtaccagaaacagcaagaattcttataggagaa
gttacttctgtaggaaaggaagaaccttttgcccatgaaaaattatctccggttttggct
atgtatagggcagaaaactttgatgatgcacttgagaaagctgtgacgcttgttaatcta
ggtggactagggcatacttcagcaatatatgcagatataataaaggcaaaagataagata
gataaattcagcaatgctatgaaaacagtaagaacttttgtgaatatacctacagctcag
ggggcaagtggagacttatataatttcaaaatagcgccttcctttacactaggttgtggt
tcttgggggggaaattccgtatcagaaaatgttggacctaaacatttgctaaatattaaa
agagtagctgagaggagagaaaatatgctttggtttagagtgcccgaaaaggtttacttc
aaatttggctgccttcaatttgcattaagagaattaaaggatttaaataagaagagggca
tttatagtaacggataaagttctttatgatctaggatatatagattctataacaaaagtt
cttgaagagataggcgttgattttaaagtattcactgaagtagaaccagatccaacacta
gctacagctagaaaaggggctgaagaaatgatggactttaaaccggataccataatatcc
cttggtggaggttcagcaatggatgcagctaaaataatgtgggtactatatgagcatcca
gaagtaagatttgaagaccttgccatgagatttatggatataagaaagagaatatacaat
ttcccaaagatgggtgaaaaagccatgatgattgctgtagcaacttcagctggaacagga
tcagaggttacaccttttgctgtaataacagatgaaaagacaggagtgaaatatccactg
gcagactatgaattaactccagacatggcaatagtagatgctgaattaatgatgaatatg
ccaaaaggattaacagctgcatcaggtatagatgcattaattcatggtatagaagcttat
acatcagtacttgcatcagaatataccaatggactggcattagaagccataagattaata
ttcaaatatttacctaaggcttattcagaaggtaccactaatgaaaaagcaagagaaaaa
atggctcatgcatcaactatggcaggaatggcctttgccaacgcattcctcggagtatgt
cattcaatggcacataaactaggggcagaacaccatatagcccatggaactgctaatgcg
ctgttaattgaagaagttatcagatttaattcggcagataatccagtaaaacaagcatca
tatcctcaatataaatatccaaatgctaaatggagatatggaaaaattgcagattattta
ggattaggcggaagtacagatgaagaaaaagttgaacttttaattaaggcaattcatgaa
ttaaaagagaaaataaatcttccaatgacaattaaggaagcaggagtctcagataaaaag
ttctatgctacacttgataagatgtgtgaacttgcttttgatgaccaatgtataggagct
aatccaaggtatccattaataagtgaaattaaacaaatgtttattaatgcttttgataag
gctgagatagatactgaaataaaatag

DBGET integrated database retrieval system