KEGG   Clostridium pasteurianum BC1: Clopa_3649Help
Entry
Clopa_3649        CDS       T02645                                 

Definition
(GenBank) NADH:flavin oxidoreductase
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
cpas  Clostridium pasteurianum BC1
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Clopa_3649
Enzymes [BR:cpas01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     Clopa_3649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN G3P_antiterm Dus
Motif
Other DBs
NCBI-ProteinID: AGK98431
UniProt: R4K9R9
Position
complement(3657805..3658818)
Genome map
AA seq 337 aa AA seqDB search
MKTFEEYVLKNLRLKNRIVLPPMDMYSADESGKANDFHYNHYTTRAIGGAGLIIVESTAV
TTNGRISDNDLGIWNDEHIDKLSNIVNSVKKYGTAIAIQLNHGGRKYVGSSGEVLAPSAI
AFDEKSKIPRELTKDGIKEIVLAFKAAAIRADKAGFDGIEIHGAHGYLIDEFLSPLSNIR
TDEYGGSTENRTRFLKEVLEAISEVWPKEKAISLRVSAEDYKIGGITGEEMVKIIDIVKP
YIDIVHVSSGGLVPADIKAYPGYQIKLAELIKEHCEISTIAVGLITDINMVEEILSNKRA
DLVALGRELLRNPYWVLNAAKAKGIEIDLPVQYKRAF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacttttgaggaatatgtattgaaaaatttacgtcttaagaacagaattgttcta
ccacctatggatatgtattcagctgatgaatctggaaaagctaatgattttcattataat
cattatactacaagagcaataggcggagcaggtttaataatagttgaatccacggcagta
acaacaaatggcagaataagtgataatgatttaggaatttggaatgatgaacatatagat
aaattaagcaacatagttaattcagttaaaaaatatggtacagctattgctattcaatta
aatcatggtggaagaaaatatgtgggtagttcaggagaggttctggcacctagcgctata
gcttttgatgaaaagagtaaaataccaagagaacttacgaaagatggcataaaagaaatt
gtattagcttttaaagcagcagctataagggctgacaaagcaggatttgatggcatagaa
atacatggagcccatggatatttaatagatgaatttttatcacctctttctaatataaga
acagatgaatatggaggaagtactgagaatagaaccagatttcttaaagaggtacttgaa
gctataagtgaagtatggcctaaggaaaaggcaatatcactgagagtttcagctgaagac
tataaaataggtggaattactggagaagaaatggttaaaattatcgatatagtaaagcca
tatattgatatagtacatgtaagctctggtggcctagttccagctgatataaaggcatac
cctggatatcagatcaaattagcagagcttattaaagagcattgtgaaatatccactata
gctgttggacttataaccgatataaatatggtagaggaaatattatcaaataaaagagca
gatttggttgctcttggtagagaactactcaggaatccttattgggtattaaatgctgct
aaggctaaaggtatagaaatagatttacctgtacagtataaacgtgctttttaa

DBGET integrated database retrieval system