KEGG   Clostridium pasteurianum BC1: Clopa_3763Help
Entry
Clopa_3763        CDS       T02645                                 

Definition
(GenBank) ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00051  Fructose and mannose metabolism
cpas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpas00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clopa_3763
Enzymes [BR:cpas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Clopa_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AGK98537
UniProt: R4K5V5
Position
complement(3783787..3784449)
Genome map
AA seq 220 aa AA seqDB search
MLEIIKKEVVKIAQEADRSGLCKHRSGNFSIRDKDTGYVVVTPSGIDREELTIHDICVID
LKANIIEIETRVKPTSELLMHLQIYKTRPDVFSVAHTHSRFATSFAVLKKEIPAVVYECS
VLGLKDGVIPVADYGRPGTTALSESVIEPIQRADAILLEGHGVVAVDKDPKEALLKAHYV
EEFAEVYYRALTLNNGKEPKVFSAEELERWKYPSQIKINE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaataattaaaaaagaagtagttaaaattgctcaggaggcagatagatcagga
ctttgcaaacatagatcaggaaactttagcattagggataaggatacaggatacgtagta
gttactccatctggcattgatagggaagaattaaccattcatgatatatgtgttatagat
ttgaaggcaaatattatagaaatagagactagggttaagccaacaagtgaactacttatg
catctacaaatatataaaacgagaccagatgtattttcagtagctcacacccattctcgt
tttgcaacttcctttgcagtattaaaaaaagaaatacctgcagttgtatatgagtgttcc
gtattaggactaaaggatggagtaataccagttgcggattatggaagaccaggtacaacg
gctttatcagagagtgttattgaacctatacagagagctgatgctatattactagaggga
catggcgtagtggctgtagataaggatcctaaagaagcccttttaaaagctcattatgta
gaggaatttgcagaagtatactatagagctcttacattaaataatggaaaagaaccaaag
gttttttcagcagaagagctggaaagatggaaatatccttctcaaataaaaataaatgag
taa

DBGET integrated database retrieval system