KEGG   Clostridium pasteurianum BC1: Clopa_3785Help
Entry
Clopa_3785        CDS       T02645                                 

Definition
(GenBank) Nucleoside-diphosphate-sugar pyrophosphorylase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00051  Fructose and mannose metabolism
cpas00520  Amino sugar and nucleotide sugar metabolism
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clopa_3785
   00520 Amino sugar and nucleotide sugar metabolism
    Clopa_3785
Enzymes [BR:cpas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Clopa_3785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 Fucokinase CTXphi_pIII-N1
Motif
Other DBs
NCBI-ProteinID: AGK98555
UniProt: R4KG28
Position
3804919..3805962
Genome map
AA seq 347 aa AA seqDB search
MKALFLAGGKGTRLKPLTDKLPKPMVPIMTKPLLERDITALKKCGIDEIVLSVCYKPQHI
KEYFQDGDRFGVKMHYVKEDVPLGTGGAIKNTEKFYDDTFLIFNSDILSDIDFKDMIKYH
KSKKADVTIAVTTVRNPSAYGVIDYDENNYAKSFIEKPSPNEITSNYINAGIYIFEPKVL
KEIPDGRVVSIERGIFPLLLKKGYKIAIYNKLSYWMDVGTPKKYFEAHRDILTGKCKIPE
LNLEKSCLYRGKNVKLHSNVKIIEPAYIGDNVEIGANTVIGPNAVIGNNCCIGTGSNIIG
SILWDNVNIGSGSKLYHSIMSSNCIMDGDSDYYNTIYTPGYTELMAI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattatttcttgcagggggtaagggaacaagattaaaacctcttacagacaaa
ttaccaaaacctatggttcccataatgacaaaaccacttttagaaagagatattacagca
cttaagaagtgtggcatagatgaaattgtattaagtgtatgttataaaccacaacatatc
aaggaatatttccaggatggagataggtttggtgttaaaatgcactatgtaaaagaagat
gttccactggggacaggaggagctataaagaataccgaaaaattttatgatgatacattt
ttgatatttaattctgatattttaagtgacatagattttaaagatatgattaaatatcac
aaaagtaaaaaggcagatgttactattgccgtaactacagtaagaaatccatcagcctat
ggagtaatagactatgatgaaaacaattatgctaaatcctttatagagaagccttctcct
aatgagattacatcaaattatataaatgcaggaatatatatatttgagcccaaggtatta
aaggaaatacctgatgggagagttgtatctatcgaaaggggaatattcccattattactg
aaaaagggatataagatagctatttataataaattatcctattggatggatgtgggtact
cctaaaaaatattttgaagcacacagagatattcttactggaaaatgtaaaataccagaa
ttaaatttagaaaaatcctgcttatatagaggtaaaaatgtaaagcttcatagtaatgta
aaaattatagaaccagcttatattggagataatgtagaaattggagctaatacagttata
ggaccaaatgcagtaataggaaacaattgctgcattggtacgggaagtaacataataggg
agtatattgtgggacaatgtaaacataggcagcggatcaaaattatatcacagcataatg
tcatcaaattgtattatggatggcgacagcgattactataataccatatatactccaggt
tatactgagcttatggcaatataa

DBGET integrated database retrieval system