KEGG   Clostridium pasteurianum BC1: Clopa_3801Help
Entry
Clopa_3801        CDS       T02645                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpas  Clostridium pasteurianum BC1
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Clopa_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_M Rhabdo_M2
Motif
Other DBs
NCBI-ProteinID: AGK98568
UniProt: R4K7Q0
Position
complement(3820470..3821516)
Genome map
AA seq 348 aa AA seqDB search
MVSISITVILIAVILIALIFALSNGLHDASSVVATCIVSGAAMPKQAIGIASIFGMIGSI
LGGSAVADTISKIIDLPVNTSMLTILLAAIMGAVIWNLVTWRLGLPSSSTHALIGGIIGS
VWVSSGYKHILWGWNELIGGQYQLTGIVKVVAGLIISPMLGFIIAFILQKVTRLLLRNAK
FTLNNSLNKLQLGIAAALAYSHGANDTQKIIGIITLALMAGKGIAINTAPLWVRIAGGLV
MFIGTMLGGWTIMRTIGRGIFKIRVIHSVNSQLASSGSLLLATFIGAPVSTTHVVVGSVM
GVGAADEYKMVHWGVAKEIILAWFITIPLSAVVSALIYSLTNFIFKVI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctatcagcataaccgtaattttaatagcagtaattttaatagcacttattttt
gcactttccaatgggctgcatgatgcaagctctgtagttgcaacctgtattgtttctggt
gcagcaatgccaaagcaagcaattggaattgcatcaatttttggaatgataggttctatt
ttaggtggaagtgcagtagcggatactatctctaagattatagatttaccagtgaatact
tccatgctcacaatacttcttgcagcaattatgggagcagttatatggaatttagtaacc
tggagattaggactgccttcaagttctacacatgctttgataggcggaataattggatca
gtatgggtgtcttcaggttataaacatatactatggggctggaatgaactaattggtgga
cagtatcaactcactggaattgtgaaagtagttgcaggtttaattatttcaccgatgctt
ggatttataattgcatttattcttcaaaaagttacgagattgttgctgaggaatgcgaaa
tttacattaaataatagtctaaataagctgcaattgggaatagctgcagcacttgcctac
agccatggtgctaatgacactcaaaaaataattggaataataaccttagcattgatggca
ggtaaaggtatagcaataaatacagcaccgctttgggtaagaatagctggcggacttgta
atgtttattggaacaatgcttggaggctggacaataatgagaactatcggtagaggaata
tttaaaataagggttattcatagcgtaaactctcaattagcttcttcagggtcactacta
ttggctacttttattggggcacccgtttctactactcatgtagttgtcggcagtgttatg
ggagttggtgcagctgacgaatataaaatggtccattggggtgtagcaaaggaaattatt
ttagcttggtttattacaataccactatctgcggtagtttctgcattgatatatagttta
actaattttattttcaaagtaatataa

DBGET integrated database retrieval system