KEGG   Clostridium pasteurianum BC1: Clopa_4387Help
Entry
Clopa_4387        CDS       T02645                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00071  Fatty acid degradation
cpas00072  Synthesis and degradation of ketone bodies
cpas00280  Valine, leucine and isoleucine degradation
cpas00310  Lysine degradation
cpas00362  Benzoate degradation
cpas00380  Tryptophan metabolism
cpas00620  Pyruvate metabolism
cpas00630  Glyoxylate and dicarboxylate metabolism
cpas00640  Propanoate metabolism
cpas00650  Butanoate metabolism
cpas00900  Terpenoid backbone biosynthesis
cpas01100  Metabolic pathways
cpas01110  Biosynthesis of secondary metabolites
cpas01120  Microbial metabolism in diverse environments
cpas01130  Biosynthesis of antibiotics
cpas01200  Carbon metabolism
cpas01212  Fatty acid metabolism
cpas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clopa_4387
   00630 Glyoxylate and dicarboxylate metabolism
    Clopa_4387
   00640 Propanoate metabolism
    Clopa_4387
   00650 Butanoate metabolism
    Clopa_4387
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Clopa_4387
   00072 Synthesis and degradation of ketone bodies
    Clopa_4387
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Clopa_4387
   00310 Lysine degradation
    Clopa_4387
   00380 Tryptophan metabolism
    Clopa_4387
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Clopa_4387
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Clopa_4387
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Clopa_4387
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpas04147]
    Clopa_4387
Enzymes [BR:cpas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Clopa_4387
Exosome [BR:cpas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clopa_4387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGK99099
UniProt: R4KEY7
Position
complement(4450875..4452053)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIASAVRTAVGSFGGSLKGVPAVDLGAAVIKEAVKRAGIKPEDVEEVVMGNVLQAG
LGQNPARQSSIKAGLPVEVSSLTINKVCGSGLRAVSLARQMILSGDADIIVAGGMENMSR
APYLVNDARWGTKMGDTKLVDEMIVDGLWDAFNNYHMGITAENIAEKWNITREDQDKFAL
ASQQKAEAAIKAGKFKDEIVPIEIPQRKGDPKIFDTDEFPRFGTTIEALAKLRPAFKKDG
TVTAGNASGINDGAAAFVIMSAEKAEELGVKPLARIAAFGSKGLDPAIMGYGPVGATKVA
LERADLKVEDLDLIEANEAFAAQSLSVVKDLNLDTDKVNVNGGAIAIGHPVGASGGRILV
TLLYEMVRRDAKTGLATLCIGGGQGTALIVKR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggtagtaatagcaagtgctgtaagaacagcagtaggttcttttggaggaagt
ttaaaaggagttccagctgtggatttaggagcagcagtaattaaagaagctgttaaaaga
gcaggaataaaaccagaagatgttgaagaagtagttatgggaaatgttcttcaggcagga
cttggacaaaatccagctagacaatcatcaataaaagcgggcttaccagtagaagtatca
tctcttacaattaataaggtgtgtggttctggtcttagagctgtatcacttgcacgtcaa
atgatattatcaggagatgctgatattatagttgctggtggtatggaaaacatgtcaaga
gctccatatttagttaatgatgctagatggggaactaaaatgggagataccaagcttgta
gatgaaatgattgtagatggtttatgggatgctttcaataattaccacatgggaataact
gctgaaaatatagcagaaaagtggaatattactagagaagatcaagataaatttgctctt
gcttcacaacaaaaagctgaagctgctataaaagctggtaaatttaaagatgaaatagtt
cctatagaaataccacagagaaagggagatcctaaaatatttgatacagatgaattccct
agatttgggactacaatagaagcattagcaaaacttagacctgctttcaaaaaagatggt
acagtaactgctggaaatgcatcaggtataaatgatggagcagcagcatttgttattatg
agtgcagaaaaggctgaagagcttggagttaaacctcttgctagaatagcagcttttggt
tcaaaaggacttgatccagctataatgggttatggaccagttggagctactaaagttgcc
cttgaaagagcagacttaaaagtagaagatttggatttaatagaagctaatgaagctttt
gcagcacaaagtttgtccgttgttaaagatttaaatttggatacagataaagttaatgtt
aatggtggagccatagctattggacatccagtaggagcttcaggtggtagaatattagtt
acacttttatatgaaatggtaagaagagatgctaaaactggtcttgcgacattatgtata
ggtggaggacaaggtacagctcttatagttaaaagataa

DBGET integrated database retrieval system