KEGG   Clostridium pasteurianum BC1: Clopa_4507Help
Entry
Clopa_4507        CDS       T02645                                 

Definition
(GenBank) ribosomal protein L22, bacterial type
  KO
K02890  large subunit ribosomal protein L22
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Clopa_4507
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpas03011]
    Clopa_4507
Ribosome [BR:cpas03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Clopa_4507
  Bacteria
    Clopa_4507
  Archaea
    Clopa_4507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGK99217
UniProt: R4K7P9
Position
complement(4572967..4573302)
Genome map
AA seq 111 aa AA seqDB search
MEARSIAKYVRMSSMKIGIVLDLIRGKNVNEAFAILQYTPKDAADVVSKVLKSAVANAEN
NLNLDINRLYVADAFTGQGSTLKRFRPHAQGRAFKIKKRTSHITLVVKERA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctagatcaatagccaagtatgtaagaatgtcttcaatgaaaataggcattgtt
cttgatttaataagaggtaaaaatgtaaatgaggctttcgctatattacaatacactcca
aaggatgcagcggatgttgtaagtaaggtattaaaatcagcggttgcaaatgcagaaaat
aatttgaatttagatataaacagattatatgttgctgatgcatttactggtcaaggttca
acattaaaaagatttagaccacacgcacaaggtagagcatttaaaattaaaaaaagaact
agtcatattaccctagttgtaaaagaaagagcataa

DBGET integrated database retrieval system